Curs valutar


1 EURO = 4.8750 RON  
1 USD = 4.1874 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoegigabitcablu utpz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfac routergatewayplugprizawirelessterouter wireless routerraspberry piaudiovideocable4 contactrcajackamikounifiraspberry pi 2 model benergytkb4k3kmxsfpddmmountableantene 24ghz802.3atmeterraftsolo10gplc2plc4door phone720pcomutatormicro switchperetemountwdm1000mswitch poeinjectormobilamesh3000ventmanagementplc8rtl8370-grconectorconectorirapidelectricdateelectriciraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfanextender3g4grg6plc16router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcoaxialinoxsirendoor lockfbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4kseoutdoor650ups120060001000010kvausbepscentrala5ghzfemalegigaethernetmiraac1200om1svcstackingcoaxvflsmbgftp5plc8-absbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2cablu ftpab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascablutvcamewradvr4ch150mmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblinda4unotesterconvertortermostatvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gaming20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetallitatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin bgftp6bgftp6pebgutp5bgutp6bgutp3bgutp5pebgftp5pebgutp6lszhbgutp6pebgutp5lszhbgsf/utp5lsnhbgftp5lszhbgftp6lszhbgf/ftp6abgf/ftp6apebgftp6alszhtooless>qrg11>xtrg11cu-mxtrg6uxtrg6mxtrg11mxtprg11cupextrg11pvcxtrg6m/txtrg6/txtrg11m/txtrg6u100xtrg6lszhxtrg11/tbgrg6ubgrg6/tbgrg6mbgrg6m/tbgrg11mbgrg11m/tbgrg6lszhbgrg6/tlszh802.3btplc4-absplc16apcbgkutp5bgkutp5pbgkutp5pem>bgkftp5>bgkftp5pema6



Vu+ DUO 4K

1,591.35 RON
pret fara TVA
cuTVA: 1,893.71 RON
VU Plus Uno 4K SE
1,426.91 RON
fara TVA
1,175.48 RON
pret fara TVA
cuTVA: 1,398.82 RON
Receptor de satelit digital VU Plus Zero4 K
660.94 RON
fara TVA
620.63 RON
pret fara TVA
cuTVA: 738.54 RON
2,677.71 RON
fara TVA
2,336.10 RON
pret fara TVA
cuTVA: 2,779.96 RON
Vu+ Solo4K
1,425.85 RON
fara TVA
1,335.67 RON
pret fara TVA
cuTVA: 1,589.45 RON
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept