Curs valutar


1 EURO = 4.7509 RON  
1 USD = 4.1988 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radio cbstatie radio autostatie radio19"rackaptavanceilingcamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicwallmountsmarthikvisionahdtviturbohdvu+fibaropducontrollersnmpshelftegatewayindustrialplugrouter wireless routerprizaunifitkbraspberry pi 2 model b3km4kamikoxsfpddmwirelessenergysoloantene 2cablemountablejackrca4 contactvideoaudioraspberry piraft4ghzmobila3000comutatorinjectorac router1000mmicro switchpereteswitch poemountdoor phone802.3at720pmeterventconectorcablu ftp2200hdmi1500fanconectorielectrics2turnrapidelectricisfp+datesolarrtl8370-grfixagertduinoraspberryip66cutieserverarduinowdm10gaeotec6000100004kse10kvaa4meshfbcoutdoor27u22uinverter650cat5ups1200lcd42ustacking sfp37udoor lockepsinoxsipfemalepopp100mmirahdvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitethernetcabluraspberry pi 3 model bextendercomborouter gigabitcentrala5ghzrazberrysirenl80750l45l60600fastrepetorpigtailapcsasiu20kvad-63048p850gaming9001000ftthsinuslaptopdellwmt60pcid6301300gigaspliterhd82651050baterieusbvera pluscamewraduo2duo 2dvr4chvu+ duo2vu+ solo2150mftpbanana probanana piab cryptobox 600hdcablu alimentarevideo interfonmotionpirgaswificoaxialtvusb stickgepongiga 850nm mc high wualitybalunmonturadoor sensorwindow sensorvgapatchtrifazicinvertor47usinrepeterw2ventilatiewallacumulatorplctermostatmicroswitchflood sensorsmoke sensorrelay switchrgbwdimmersocketblindunotesterconvertormetalic



Amiko A5 combo
518.00 RON
fara TVA
440.00 RON
pret fara TVA
Receptor de satelit digital VU Plus Zero4 K
588.00 RON
fara TVA
554.60 RON
pret fara TVA
410.00 RON
fara TVA
351.00 RON
pret fara TVA
2,524.00 RON
fara TVA
2,202.00 RON
pret fara TVA
Vu+ Solo4K
1,344.00 RON
fara TVA
1,259.00 RON
pret fara TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept