Curs valutar

13-Aug-2020

1 EURO = 4.8344 RON  
1 USD = 4.0836 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoegigabitcablu utpz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfac routergatewayplugprizawirelessterouter wireless routerraspberry piaudiovideocable4 contactrcajackamikounifiraspberry pi 2 model benergytkb4k3kmxsfpddmmountableantene 24ghz802.3atmeterraftsolo10gplc2plc4door phone720pcomutatormicro switchperetemountwdm1000mswitch poeinjectormobilamesh3000ventplc8rtl8370-grconectorconectorirapidelectricdateelectriciraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfanextender3g4gmanagementrg6plc16router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4kseoutdoor650ups120060001000010kvausbepscentrala5ghzfemalegigaethernetmiraac1200om1svcstackingcoaxvflsmbgftp5plc8-absbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2cablu ftpab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascablutvcamewradvr4ch150mmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gaming20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetallitatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin bgftp6bgftp6pebgutp5bgutp6bgutp3bgutp5pebgftp5pebgutp6lszhbgutp6pebgutp5lszhbgsf/utp5lsnhbgftp5lszhbgftp6lszhbgf/ftp6abgf/ftp6apebgftp6alszhtooless>qrg11>xtrg11cu-mxtrg6uxtrg6mxtrg11mxtprg11cupextrg11pvcxtrg6m/txtrg6/txtrg11m/txtrg6u100xtrg6lszhxtrg11/tbgrg6ubgrg6/tbgrg6mbgrg6m/tbgrg11mbgrg11m/tbgrg6lszhbgrg6/tlszh802.3btplc4-absplc16apc

ANPC

 » Routere wireless



WF2780

super gigabit router dualband AC1200, 4 port LAN gigabit, 4 antene 5dB, MIMO

Netis - WF2780

All mode AC giga-router foarte fiabil si competenet, cu WAN si 4*LAN gigabit, la cel mai bun raport pret/ calitate de pe piata.
Routerul WF2780 ofera noua generatie de WI-FI la viteze gigabit. Ofera conexiuni wireless de pana la 1200 Mbps (300Mbps N + 867 Mbps AC) cu tehnologie WI-FI 802.11AC pe 2 benzi simultane, evitand interferentele si asigurand conexiuni de incredere si viteze WI-FI de varf. Este ideal pentru solutii cu multe echipamente conectate simultan la streaming video.

Alte imagini:
WF2780WF2780WF2780WF2780
 





Pret vechi fara TVA :
168,68 RON


Pret nou fara TVA :
154,89 RON

Pret nou cu TVA :
184,32 RON

Disponibilitate :
Sunati

 

Wireless
Standards IEEE 802.11b/g/n 2.4GHz
IEEE 802.11a/n/ac 5GHz
Signal Rate Up to 300Mbps2.4GHz
UP to 867Mbps 5GHz
Frequency Range 2.4-2.4835GHz; 5.180-5.825GHz
Transmit Power 20dBm(MAX)
Data Transfer Rate 802.11ac:
80MHz(433Mbps, 867Mbps)
802.11n:
40MHz(300Mbps, 270Mbps, 240Mbps, 180Mbps, 120Mbps, 90Mbps, 60Mbps, 30Mbps)
20MHz (144Mbps, 130Mbps, 115Mbps, 86Mbps, 57Mbps, 43Mbps, 28Mbps, 14Mbps) (Auto-Sense)
801.11g:
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
802.11b:
(11Mbps,9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)
Wireless Mode AP, WDS, AP+WDS, Repeater, Client, Multiple AP
Wireless Security 64/128-bit WEP,
WPA-PSK/WPA2-PSK (TKIP/AES), WPA/WPA2
SSID Broadcast Enable/Disable
Wireless MAC Filtering
Hardware
Standards IEEE 802.3 10Base-T, IEEE 802.3u 100Base-TX,
IEEE 802.3u 1000Base-TX
Interface 1 *10/100/1000M Auto MDI/MDIX RJ45 WAN port
4 *10/100/1000M Auto MDI/MDIX RJ45 LAN port
LED PWR, WPS,SYS,2.4G, 5G, LAN1 ~4, WAN , WPS
Button Default, WPS
Antenna 4 * external 5dBi antenna, omni-directional
Power Supply DC 12V/1A(Output)
Dimensions (L x W x H ) 145 x 155 x 35mm
Weight 285g
Software
WAN Type DHCP, Static IP, PPPoE, L2TP, PPTP, Dual Access, WISP
Port Forwarding Virtual Servers, Port Triggering, UPnP, DMZ, FTP Private Port
QoS WMM, Bandwidth Control
Access Control IP/MAC/Domain Filtering
VPN Pass-through PPTP, L2TP, IPSEC
Others DDNS, Static Routing, WOL, Remote Management, Firmware upgrade, Backup & Restore
Others
Certification FCC, CE, KC
Environment Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
Package 1 * WF2780
1 * 12V/1A Power Adapter
1 * Ethernet Cable
1 * Cradle
1 * Quick Installation Guide
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept