Curs valutar


1 EURO = 4.7224 RON  
1 USD = 4.1521 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148v


 » Routere wireless


super gigabit router dualband AC1200, 4 port LAN gigabit, 4 antene 5dB, MIMO

Netis - WF2780

All mode AC giga-router foarte fiabil si competenet, cu WAN si 4*LAN gigabit, la cel mai bun raport pret/ calitate de pe piata.
Routerul WF2780 ofera noua generatie de WI-FI la viteze gigabit. Ofera conexiuni wireless de pana la 1200 Mbps (300Mbps N + 867 Mbps AC) cu tehnologie WI-FI 802.11AC pe 2 benzi simultane, evitand interferentele si asigurand conexiuni de incredere si viteze WI-FI de varf. Este ideal pentru solutii cu multe echipamente conectate simultan la streaming video.

Alte imagini:

Pret vechi:
159,00 RON fara TVA

Pret nou:
146,00 RON

*) Pretul nu contine TVA
Disponibilitate :


Standards IEEE 802.11b/g/n 2.4GHz
IEEE 802.11a/n/ac 5GHz
Signal Rate Up to 300Mbps2.4GHz
UP to 867Mbps 5GHz
Frequency Range 2.4-2.4835GHz; 5.180-5.825GHz
Transmit Power 20dBm(MAX)
Data Transfer Rate 802.11ac:
80MHz(433Mbps, 867Mbps)
40MHz(300Mbps, 270Mbps, 240Mbps, 180Mbps, 120Mbps, 90Mbps, 60Mbps, 30Mbps)
20MHz (144Mbps, 130Mbps, 115Mbps, 86Mbps, 57Mbps, 43Mbps, 28Mbps, 14Mbps) (Auto-Sense)
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
(11Mbps,9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)
Wireless Mode AP, WDS, AP+WDS, Repeater, Client, Multiple AP
Wireless Security 64/128-bit WEP,
SSID Broadcast Enable/Disable
Wireless MAC Filtering
Standards IEEE 802.3 10Base-T, IEEE 802.3u 100Base-TX,
IEEE 802.3u 1000Base-TX
Interface 1 *10/100/1000M Auto MDI/MDIX RJ45 WAN port
4 *10/100/1000M Auto MDI/MDIX RJ45 LAN port
Button Default, WPS
Antenna 4 * external 5dBi antenna, omni-directional
Power Supply DC 12V/1A(Output)
Dimensions (L x W x H ) 145 x 155 x 35mm
Weight 285g
WAN Type DHCP, Static IP, PPPoE, L2TP, PPTP, Dual Access, WISP
Port Forwarding Virtual Servers, Port Triggering, UPnP, DMZ, FTP Private Port
QoS WMM, Bandwidth Control
Access Control IP/MAC/Domain Filtering
VPN Pass-through PPTP, L2TP, IPSEC
Others DDNS, Static Routing, WOL, Remote Management, Firmware upgrade, Backup & Restore
Certification FCC, CE, KC
Environment Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
Package 1 * WF2780
1 * 12V/1A Power Adapter
1 * Ethernet Cable
1 * Cradle
1 * Quick Installation Guide
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept