Curs valutar

22-Jul-2019

1 EURO = 4.7315 RON  
1 USD = 4.2103 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20km

ANPC
Rezultatele cautarii pentru : ups braun group - 1252 inregistrari
Pagina: 12345678910
Proiector LED,tip COB,50WProiector LED,tip COB,50W,lumina calda Braun Group - BGFL50-CWW

Proiector LED, LED Flood Light,50W,COB LED,AC85-265V,120° Lens,IP65

Pret vechi 71.00 RON
Pret nou
52.01 RON
*) Pretul nu contine TVA
cuTVA: 61.89 RON
Disponibilitate : Sunati
Proiector LED,tip COB,50WProiector LED,tip COB,50W,lumina rece Braun Group - BGFL50-CPW

Proiector LED, LED Flood Light,50W,COB LED,AC85-265V,120° Lens,IP65

Pret vechi 71.00 RON
Pret nou
52.01 RON
*) Pretul nu contine TVA
cuTVA: 61.89 RON
Disponibilitate : Sunati
Proiector LED,tip COB,30WProiector LED,tip COB,30W,lumina calda Braun Group - BGFL30-CWW

Proiector LED, LED Flood Light,30W,COB LED,AC85-265V,120° Lens,IP65

Pret vechi 55.00 RON
Pret nou
34.36 RON
*) Pretul nu contine TVA
cuTVA: 40.89 RON
Disponibilitate : Sunati
Proiector LED,tip COB,30WProiector LED,tip COB,30W,lumina rece Braun Group - BGFL30-CPW

Proiector LED, LED Flood Light,30W,COB LED,AC85-265V,120° Lens,IP65

Pret vechi 55.00 RON
Pret nou
34.36 RON
*) Pretul nu contine TVA
cuTVA: 40.89 RON
Disponibilitate : Sunati
Proiector LED,tip COB,20WProiector LED,tip COB,20W,lumina calda Braun Group - BGFL20-CWW

Proiector LED, LED Flood Light,20W,COB LED,AC85-265V,120° Lens,IP65,2700-3500K

Pret vechi 40.00 RON
Pret nou
29.25 RON
*) Pretul nu contine TVA
cuTVA: 34.81 RON
Disponibilitate : Sunati
Proiector LED,tip COB,20WProiector LED,tip COB,20W,lumina rece Braun Group - BGFL20-CPW

Proiector LED, LED Flood Light,20W,COB LED,AC85-265V,120° Lens,IP65

Pret vechi 40.00 RON
Pret nou
29.25 RON
*) Pretul nu contine TVA
cuTVA: 34.81 RON
Disponibilitate : Sunati
Proiector LED,tip COB,10WProiector LED,tip COB,10W,lumina calda Braun Group - BGFL10-CWW

Proiector LED, LED Flood Light,10W,COB LED,AC85-265V,120° Lens,IP65,2700-3500K

Pret vechi 38.00 RON
Pret nou
16.72 RON
*) Pretul nu contine TVA
cuTVA: 19.90 RON
Disponibilitate : Sunati
Proiector LED,tip COB,10WProiector LED,tip COB,10W,lumina rece Braun Group - BGFL10-CPW

Proiector LED, LED Flood Light,10W,COB LED,AC85-265V,120° Lens,IP65

Pret vechi 38.00 RON
Pret nou
16.72 RON
*) Pretul nu contine TVA
cuTVA: 19.90 RON
Disponibilitate : Sunati
NF-468BLTester Retea Braun Group - NF-468BL

Tester retea cablu UTP/FTP/telefonic/coaxial, mufe RJ45/RJ11/BNC, alimentare cu baterie 9V

Pret : 27.21 RON
*) Pretul nu contine TVA
cuTVA: 32.38 RON
Disponibilitate : Sunati
YK13-12V2,5ASursa alimentare DC12V/ 2,5A Full protection Braun Group - YK13-12V2,5A

Sursa alimentare in comutatie DC12V 2500mA, cu tripla protectie SC, OV,OC ( scurt circuit, over-voltage, over current), Auto recovery (auto-restart  = repornire automata dupa terminarea avariei)
EU Plug Camera Power Supply, Input Voltage: AC 110--240V, Output Voltage: DC 12V; CE & RoHS
Low voltage Jack O.D. 5.5/ I.D 2.1mm (camere video)   sau 5.5 mm /2.5 mm (DVR, STB, routers,...).
Sursa functioneaza in orice conditii nefiind necesara restartarea manuala dupa terminarea evenimentului care a declansat intrarea in functiune a protectiei.

Pret vechi 33.59 RON
Pret nou
23.18 RON
*) Pretul nu contine TVA
cuTVA: 27.59 RON
Disponibilitate : Indisponibil
F/FTP cat6A LSZHCablu FTP cat6A LSZH AWG23 Cupru solid Braun Group - F/FTP cat6A LSZH

Cablu FTP cat6A, LSZH, 4x2xAWG23, 100% cupru solid, ecranat cu folie de aluminiu, manta LSZH, diametru exterior 7,7mm, culoare albastru, temperaturi de operare -20+75 grade Celsius, role 305m, Clasa de reactie la foc conform EN50575 : Eca, CE, RoHS, cod EAN 5949022103397, FLUKE PASS

Pret : 1.99 RON
*) Pretul nu contine TVA
cuTVA: 2.36 RON
Disponibilitate : Sunati
AHD-CI20E-200ECamera exterior 2Mpx, IR20m Braun Group - AHD-CI20E-200E

Camera de supraveghere AHD 2Mpx cu infrarosu, senzor CMOS: OV2710+NVP2441H, 1/3" 1080p , IR-CUT    

Weatherproof IR Camera
24 pcs*¢5mm IR LED
IR Distance 20M

3-Axis Bracket Hidden cable design

Built-in 3.6mm ICR Lens
Water resistance:IP66

Weight:0.5Kg

Pret vechi 126.00 RON
Pret nou
92.00 RON
*) Pretul nu contine TVA
cuTVA: 109.48 RON
Disponibilitate : Sunati
HSP-CM1099Camera camuflata PIR 800 TVL Braun Group - HSP-CM1099

Camera Analogica HSP-CM1099 tip PIR camuflaj 800 linii, lentila 3.7mm

 

  • HSP-CM1099
  • Camera camuflata in forma de detector PIR
  • CMOS 1/3 ''
  • 0.8Lux / F2.0
  • Resolution: 800 lines
  • Lens: 3.7mm
  • 12V DC, 50mA
  • Dimensions: 70x50x120mm
Pret vechi 84.00 RON
Pret nou
23.30 RON
*) Pretul nu contine TVA
cuTVA: 27.73 RON
Disponibilitate : Sunati
GDB60_negruTava fixa pt rack 600*600 Braun Group - GDB60-LN (negru)

Tava fixa pentru rack 19'' cu adancime 600mm, seria Braun Group TExxxx. Dimensiune: 470*350 mm. culoare neagra.

Pret : 37.85 RON
*) Pretul nu contine TVA
cuTVA: 45.04 RON
Disponibilitate : Sunati
MW-FTTB-ORReceptor optic FTTB Braun Group - MW-FTTB-OR
Receptor optic Braun Group FTTB, intrare 1200-1600nm, nivel intrare -16+3dBm, conector SC/APC, 2 iesiri RF x 106dBuV, 47-862MHz, AGC optic in plaja -5+2dBm, control digital cu display pentru tilt si atenuare 0-20dB. Alimentare VDC 12V, consum <25W, dimensiuni 190x145x40mm.
Pret : 179.80 RON
*) Pretul nu contine TVA
cuTVA: 213.96 RON
Disponibilitate : Sunati
MW-FTTH-WDMReceptor optic PON FTTH mininode, 2 iesiri RF, PON output port (1310/1490 WDM filter for GPON or GEPON ) Braun Group - MW-FTTH-WDM
Minireceptor optic FTTH de interior, intrare optica 1310/1490/1550nm, nivel optic –12+0dBm, conector optic intrare SC/APC, iesire PON 1310/1490nm, conector optic iesire PON SC/PC, banda RF la iesire 47-2600MHz ( CATV & SMATV), 2 iesiri RF pe mufa F, nivel iesire RF 80-95dB,
reglare nivel RF iesire 0-20dB, alimentare 12VDC, dimensiuni 97x96x32mm
Pret : 104.09 RON
*) Pretul nu contine TVA
cuTVA: 123.87 RON
Disponibilitate : Sunati
NF-889Tester Retea multifunctional NF-889 Braun Group - NF-889
Detector de cabluri neconectate la tensiune, sub pamant sau in pereti. Wiremap pentru cabluri de date pe conector RJ45.
Echipamentul este format din transmitator de ton cu frecventa de 1000Hz si receptor. Transmitatorul se leaga la capatul cablului ce trebuie detectat ( electric, de date, telefonic, conducte metalice). Receptorul (scaner) este prevazut cu o antena de detectie, indicator LED si mufa jack pentru casti externe (incluse). Atat emitatorul cat si receptorul se alimenteaza de la baterii de 9VDC (neincluse). Temperaturi de operare -10+50 grade Celsius
Pret : 137.21 RON
*) Pretul nu contine TVA
cuTVA: 163.28 RON
Disponibilitate : Sunati
SC/APC - FC/APCAdaptor FC/PC SingleMode simplex Braun Group - SC/APC - FC/APC

Adaptor SC/APC - FC/APC SingleMode simplex

Pret : 2.84 RON
*) Pretul nu contine TVA
cuTVA: 3.38 RON
Disponibilitate : Sunati
BG-X4ADHTester portabil CCTV HD 4", Camere IP, TVI, CVI, AHD, CVBS Braun Group - BG-X4ADH

4inch touch screen TVI,CVI,AHD,IP,CVBS tester 

Pret vechi 1,600.00 RON
Pret nou
1,396.00 RON
*) Pretul nu contine TVA
cuTVA: 1,661.24 RON
Disponibilitate : In asteptare
BG-X9ADHSTester CCTV HD 8" retina display, touch screen all-in-one, multi-functional Braun Group - BG-X9ADHS

8 inch 2K retina display with Anti-sunlight Cover HD CCTV tester       

- 8 inch Retina touch screen,2048*1536 resolution                
- 8MP TVI,8MP CVI,5MP AHD and SDI/EX-SDI test 
- H.265/H.264,4K video display via mainstream                   
- Dual window test,IP &Analog camera test
- Built in WIFI,create WIFI hotspot                               
- HDMI input and 4K output
- HD Coaxial video signal quality and level meter test              
- RJ45 cable TDR test,cable quality test               
- DC12V 3A, DC48V PoE power output                           
- 4 channels Rapid ONVIF,auto view video,and create testing report
- Anti-sunlight board,help shade the eyes of engineers from the glare of sunlight.
- TesterPlay,tester,android version mobile phone and PC display at the same time 

Pret vechi 2,999.00 RON
Pret nou
2,429.00 RON
*) Pretul nu contine TVA
cuTVA: 2,890.51 RON
Disponibilitate : In asteptare
Pagina: 12345678910
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept