Curs valutar

16-Sep-2019

1 EURO = 4.7354 RON  
1 USD = 4.2654 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte

ANPC
Rezultatele cautarii pentru : ups braun group - 1246 inregistrari
Pagina: 12345678910
Proiector LED,tip SMD,100WProiector LED,tip SMD,100W,lumina rece Braun Group - BGFL100-MPW

Proiector LED, LED Flood Light,100W,SMD LED,AC85-265V,120° Lens,IP66

Pret vechi 142.00 RON
Pret nou
83.12 RON
*) Pretul nu contine TVA
cuTVA: 98.91 RON
Disponibilitate : Sunati
ADSS 2.5KNADSS 2,5KN 48 fibre SM G652D (4x12) Braun Group - ADSS 2.5KN 48 fibre

Cablu optic ADSS 2,5KN 48xSM G652D (4x12), multitub (loose tube gel filled), A-DQ(ZN)2Y - AERIAN, metalfree, longitudinal waterbloking, aramid yarns, manta PE, protectie UV, distanta intre stalpi 30-60m (functie de conditiile de instalare/conditiile de mediu), diametru : 11,8mm, greutate : 107 kg/km, tensiune maxima de intindere: 2,5 kN, raza min. de curbura : 236mm, temp. de operare : -40+60 grade Celsius, lungime rola : 4km

Pret : 4.88 RON
*) Pretul nu contine TVA
cuTVA: 5.80 RON
Disponibilitate : Sunati
BGFL2000-MWWProiector LED,tip SMD,200W,lumina calda Braun Group - BGFL200-MWW

Proiector LED, LED Flood Light,200W,SMD LED,AC85-265V,120° Lens,IP66

Pret vechi 300.00 RON
Pret nou
185.28 RON
*) Pretul nu contine TVA
cuTVA: 220.48 RON
Disponibilitate : Sunati
BGFL2000-MPWProiector LED,tip SMD,200W,lumina rece Braun Group - BGFL200-MPW

Proiector LED, LED Flood Light,200W,SMD LED,AC85-265V,120° Lens,IP66

Pret vechi 300.00 RON
Pret nou
185.28 RON
*) Pretul nu contine TVA
cuTVA: 220.48 RON
Disponibilitate : Sunati
Proiector LED,tip COB,100WProiector LED,tip COB,100W,lumina rece Braun Group - BGFL100-CPW

Proiector LED, LED Flood Light,100W,COB LED,AC85-265V,120° Lens,IP65,2x50W

Pret vechi 160.00 RON
Pret nou
83.12 RON
*) Pretul nu contine TVA
cuTVA: 98.91 RON
Disponibilitate : Sunati
Proiector LED,tip COB,50WProiector LED,tip COB,50W,lumina calda Braun Group - BGFL50-CWW

Proiector LED, LED Flood Light,50W,COB LED,AC85-265V,120° Lens,IP65

Pret vechi 71.00 RON
Pret nou
52.01 RON
*) Pretul nu contine TVA
cuTVA: 61.89 RON
Disponibilitate : Sunati
Proiector LED,tip COB,50WProiector LED,tip COB,50W,lumina rece Braun Group - BGFL50-CPW

Proiector LED, LED Flood Light,50W,COB LED,AC85-265V,120° Lens,IP65

Pret vechi 71.00 RON
Pret nou
52.01 RON
*) Pretul nu contine TVA
cuTVA: 61.89 RON
Disponibilitate : Sunati
Proiector LED,tip COB,30WProiector LED,tip COB,30W,lumina calda Braun Group - BGFL30-CWW

Proiector LED, LED Flood Light,30W,COB LED,AC85-265V,120° Lens,IP65

Pret vechi 55.00 RON
Pret nou
34.36 RON
*) Pretul nu contine TVA
cuTVA: 40.89 RON
Disponibilitate : Sunati
Proiector LED,tip COB,30WProiector LED,tip COB,30W,lumina rece Braun Group - BGFL30-CPW

Proiector LED, LED Flood Light,30W,COB LED,AC85-265V,120° Lens,IP65

Pret vechi 55.00 RON
Pret nou
34.36 RON
*) Pretul nu contine TVA
cuTVA: 40.89 RON
Disponibilitate : Sunati
Proiector LED,tip COB,20WProiector LED,tip COB,20W,lumina calda Braun Group - BGFL20-CWW

Proiector LED, LED Flood Light,20W,COB LED,AC85-265V,120° Lens,IP65,2700-3500K

Pret vechi 40.00 RON
Pret nou
29.25 RON
*) Pretul nu contine TVA
cuTVA: 34.81 RON
Disponibilitate : Sunati
Proiector LED,tip COB,20WProiector LED,tip COB,20W,lumina rece Braun Group - BGFL20-CPW

Proiector LED, LED Flood Light,20W,COB LED,AC85-265V,120° Lens,IP65

Pret vechi 40.00 RON
Pret nou
29.25 RON
*) Pretul nu contine TVA
cuTVA: 34.81 RON
Disponibilitate : Sunati
Proiector LED,tip COB,10WProiector LED,tip COB,10W,lumina calda Braun Group - BGFL10-CWW

Proiector LED, LED Flood Light,10W,COB LED,AC85-265V,120° Lens,IP65,2700-3500K

Pret vechi 38.00 RON
Pret nou
16.72 RON
*) Pretul nu contine TVA
cuTVA: 19.90 RON
Disponibilitate : Sunati
Proiector LED,tip COB,10WProiector LED,tip COB,10W,lumina rece Braun Group - BGFL10-CPW

Proiector LED, LED Flood Light,10W,COB LED,AC85-265V,120° Lens,IP65

Pret vechi 38.00 RON
Pret nou
16.72 RON
*) Pretul nu contine TVA
cuTVA: 19.90 RON
Disponibilitate : Sunati
NF-468BLTester Retea Braun Group - NF-468BL

Tester retea cablu UTP/FTP/telefonic/coaxial, mufe RJ45/RJ11/BNC, alimentare cu baterie 9V

Pret : 27.23 RON
*) Pretul nu contine TVA
cuTVA: 32.40 RON
Disponibilitate : Sunati
YK13-12V2,5ASursa alimentare DC12V/ 2,5A Full protection Braun Group - YK13-12V2,5A

Sursa alimentare in comutatie DC12V 2500mA, cu tripla protectie SC, OV,OC ( scurt circuit, over-voltage, over current), Auto recovery (auto-restart  = repornire automata dupa terminarea avariei)
EU Plug Camera Power Supply, Input Voltage: AC 110--240V, Output Voltage: DC 12V; CE & RoHS
Low voltage Jack O.D. 5.5/ I.D 2.1mm (camere video)   sau 5.5 mm /2.5 mm (DVR, STB, routers,...).
Sursa functioneaza in orice conditii nefiind necesara restartarea manuala dupa terminarea evenimentului care a declansat intrarea in functiune a protectiei.

Pret vechi 33.62 RON
Pret nou
23.20 RON
*) Pretul nu contine TVA
cuTVA: 27.61 RON
Disponibilitate : Indisponibil
F/FTP cat6A LSZHCablu FTP cat6A LSZH AWG23 Cupru solid Braun Group - F/FTP cat6A LSZH

Cablu FTP cat6A, LSZH, 4x2xAWG23, 100% cupru solid, ecranat cu folie de aluminiu, manta LSZH, diametru exterior 7,7mm, culoare albastru, temperaturi de operare -20+75 grade Celsius, role 305m, Clasa de reactie la foc conform EN50575 : Eca, CE, RoHS, cod EAN 5949022103397, FLUKE PASS

Pret : 1.99 RON
*) Pretul nu contine TVA
cuTVA: 2.37 RON
Disponibilitate : Sunati
AHD-CI20E-200ECamera exterior 2Mpx, IR20m Braun Group - AHD-CI20E-200E

Camera de supraveghere AHD 2Mpx cu infrarosu, senzor CMOS: OV2710+NVP2441H, 1/3" 1080p , IR-CUT    

Weatherproof IR Camera
24 pcs*¢5mm IR LED
IR Distance 20M

3-Axis Bracket Hidden cable design

Built-in 3.6mm ICR Lens
Water resistance:IP66

Weight:0.5Kg

Pret vechi 126.00 RON
Pret nou
92.00 RON
*) Pretul nu contine TVA
cuTVA: 109.48 RON
Disponibilitate : Sunati
HSP-CM1099Camera camuflata PIR 800 TVL Braun Group - HSP-CM1099

Camera Analogica HSP-CM1099 tip PIR camuflaj 800 linii, lentila 3.7mm

 

  • HSP-CM1099
  • Camera camuflata in forma de detector PIR
  • CMOS 1/3 ''
  • 0.8Lux / F2.0
  • Resolution: 800 lines
  • Lens: 3.7mm
  • 12V DC, 50mA
  • Dimensions: 70x50x120mm
Pret vechi 84.00 RON
Pret nou
23.30 RON
*) Pretul nu contine TVA
cuTVA: 27.73 RON
Disponibilitate : Sunati
GDB60_negruTava fixa pt rack 600*600 Braun Group - GDB60-LN (negru)

Tava fixa pentru rack 19'' cu adancime 600mm, seria Braun Group TExxxx. Dimensiune: 470*350 mm. culoare neagra.

Pret : 37.88 RON
*) Pretul nu contine TVA
cuTVA: 45.08 RON
Disponibilitate : Sunati
MW-FTTB-ORReceptor optic FTTB Braun Group - MW-FTTB-OR
Receptor optic Braun Group FTTB, intrare 1200-1600nm, nivel intrare -16+3dBm, conector SC/APC, 2 iesiri RF x 106dBuV, 47-862MHz, AGC optic in plaja -5+2dBm, control digital cu display pentru tilt si atenuare 0-20dB. Alimentare VDC 12V, consum <25W, dimensiuni 190x145x40mm.
Pret : 179.95 RON
*) Pretul nu contine TVA
cuTVA: 214.13 RON
Disponibilitate : Sunati
Pagina: 12345678910
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept