Curs valutar

01-Jun-2020

1 EURO = 4.8426 RON  
1 USD = 4.3517 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpgigabitz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerplugprizaraspberry piaudiovideocable4 contactrcajackamikoac routerunifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin

ANPC
Rezultatele cautarii pentru : planet - 108 inregistrari
Pagina: 123456
ISW-511TISW-511T/ISW-511TS Planet - ISW-511T

4-Port 10/100Base-TX + 1-Port 100Base-FX Industrial Ethernet Switch

Pret vechi 338.98 RON
Pret nou
297.97 RON
*) Pretul nu contine TVA
cuTVA: 354.59 RON
Disponibilitate : Sunati
POE-172Single-Port 10/100/1000Mbps Ultra PoE Injector (60W) Planet - POE-172

PLANET POE-172 Ultra Power over Ethernet Injector provides a maximum of 60watt power and high-speed Ethernet data connection anywhere in your network infrastructure.

Pret vechi 227.60 RON
Pret nou
159.26 RON
*) Pretul nu contine TVA
cuTVA: 189.52 RON
Disponibilitate : Sunati
POE-171SSingle-Port 10/100/1000Mbps Ultra PoE Splitter (12V/19V/24V) Planet - POE-171S

PoE Splitter -56V, tensiune iesire 12V; 9V; 24V
Receptor adaptor PoE, se conformeaza IEEE 802.3at/af, permite transfer de date si de energie pe acelasi cablu pana la 100m, carcasa plastic, format de buzunar, plug and play, RoHS:

Pret : 266.34 RON
*) Pretul nu contine TVA
cuTVA: 316.95 RON
Disponibilitate : Sunati
POE-171Single-Port 10/100/1000Mbps Ultra PoE Injector (60 Watts) Planet - POE-171

POE injector gigabit: 1 port PoE, se conformeaza IEEE 802.3at/af, permite transfer de date si de energie pe acelasi cablu pana la 100m, carcasa metal, format de buzunar, plug and play, RoHS.

Pret : 242.13 RON
*) Pretul nu contine TVA
cuTVA: 288.13 RON
Disponibilitate : Sunati
IGS-5225-8P4SSwitch Industrial 8-Port 10/100/1000T 802.3at PoE+, 4-Port 100/1000X SFP Planet - IGS-5225-8P4S

Switch Industrial 8-Port 10/100/1000T 802.3at PoE+ , 4-Port 100/1000X SFP, (-40 ~ 75 °C)

Pret : 2,179.17 RON
*) Pretul nu contine TVA
cuTVA: 2,593.21 RON
Disponibilitate : Sunati
POE-151-EUIEEE 802.3af POE Injector (Mid-Span) Planet - POE-151-EU

IEEE 802.3af Power Over Ethernet Injector (Mid-Span)

Pret : 111.38 RON
*) Pretul nu contine TVA
cuTVA: 132.54 RON
Disponibilitate : Sunati
GSW-240124-Port 10/100/1000Mbps Gigabit Ethernet Switch Planet - GSW-2401

24-Port 10/100/1000Mbps Gigabit Ethernet Switch

Pret : 406.78 RON
*) Pretul nu contine TVA
cuTVA: 484.07 RON
Disponibilitate : Sunati
IGS-624HPTSwitch Industrial 4-Port 10/100/1000T 802.3at PoE+, 2-Port 100/1000X SFP Planet - IGS-624HPT

Switch Industrial 4-Port 10/100/1000T 802.3at PoE+ , 2-Port 100/1000X SFP

Pret : 1,279.24 RON
*) Pretul nu contine TVA
cuTVA: 1,522.30 RON
Disponibilitate : Sunati
POE-E3041-Port Ultra PoE to 4-Port 802.3af/at Gigabit PoE Extender Planet - POE-E304

PLANET POE-E304 is a 1-port 60W Ultra PoE to 4-port 802.3af/at Gigabit PoE Extender designed especially for point to multipoint PoE applications. The POE-E304 can obtain a maximum of 60-watt PoE power from Ultra PoE input port and supplies a maximum of 55-watt PoE power budget for four PoE output ports, extending both the Gigabit Ethernet Data and IEEE 802.3at/802.3af Power over Ethernet over the standard 100m (328 ft.) Cat. 5/5e/6 UTP cable to up to two 200m powered devices at the same time.

Pret : 266.34 RON
*) Pretul nu contine TVA
cuTVA: 316.95 RON
Disponibilitate : Sunati
POE TESTERTester PoE IEEE 802.3af/at Planet - POE TESTER

Quickly tests RJ-45 outlet for Power over Ethernet existence, Two LEDs indicate the types of PSE (power source equipment),End-span PoE switch- Mid-span PoE injector / injector hub- 4-pair, 60-watt ultra PoE injector,Compliant with IEEE 802.3at/af PoE standard, Plug and Play design

 

Pret : 54.97 RON
*) Pretul nu contine TVA
cuTVA: 65.42 RON
Disponibilitate : Sunati
GSW-1601Switch Gigabit 16porturi 10/100/1000Mbps Planet - GSW-1601

Switch Gigabit 16porturi 10/100/1000Mbps

Pret : 324.45 RON
*) Pretul nu contine TVA
cuTVA: 386.10 RON
Disponibilitate : Sunati
GS-4210-24PL4CSwitch POE Gigabit 24 port + 4 port Combo TP/SFP (440W) Planet - GS-4210-24PL4C

24-Port 10/100/1000T 802.3at PoE + 4-Port Gigabit TP/SFP Combo Managed Switch

Pret : 2,009.68 RON
*) Pretul nu contine TVA
cuTVA: 2,391.52 RON
Disponibilitate : Sunati
VF-106-KITKit Media Convertor Video Wall Mount Planet - VF-106-KIT

1-Channel video over fiber bundled kit (VF-106-T + VF-106-R), Video and Data over fiber transmission, 8 bit Video Signal digital sampling, PAL, NTSC, SECAM compatible, 20km max. transmission distance , RS-485, High-speed synchronous digital transmission technology, Safe transmission guaranteed under poor electromagnetic environment, Standalone or work with PLANET MC-700/1500/1500R/1500R48 media converter chassis, Compact size, wall-mount design, easy installation

 
Pret vechi 861.98 RON
Pret nou
744.94 RON
*) Pretul nu contine TVA
cuTVA: 886.48 RON
Disponibilitate : Sunati
MC-1500-EUSasiu 15 sloturi media convertoare rackabil Planet - MC-1500-EU

Sasiu 19inch cu 15 sloturi pentru Media Convertoare, 2 ventilatoare pe panoul din spate cu indicatori led asigura fluxul de aer pentru raqcirea sistemului, suporta convertoare multiple 10/100/1000Mbps, cupru, fibra, conectori single/multi-mode ST/SC/MTRJ.

Pret : 1,041.16 RON
*) Pretul nu contine TVA
cuTVA: 1,238.98 RON
Disponibilitate : Sunati
FNSW-1600P16-Port 10/100Mbps PoE Fast Ethernet Switch Planet - FNSW-1600P

16-Port 10/100Mbps PoE Fast Ethernet Switch

Pret vechi 581.11 RON
Pret nou
565.13 RON
*) Pretul nu contine TVA
cuTVA: 672.50 RON
Disponibilitate : Sunati
front8-Port 10/100TX PoE + 2-Port Gigabit TP/SFP Combo, LCD Planet - FGSD-1022VHP

8-Port 10/100TX 802.3at PoE + 2-Port Gigabit TP/SFP combo Desktop Switch with LCD PoE Monitor (120 Watts)

Pret : 619.85 RON
*) Pretul nu contine TVA
cuTVA: 737.62 RON
Disponibilitate : Sunati
IGT-805ATIndustrial 10/100/1000BASE-T to 100/1000BASE-X SFP Media Converter Planet - IGT-805AT

Industrial 10/100/1000BASE-T to 100/1000BASE-X SFP Media Converter (-40~75 degrees C)

Pret : 372.88 RON
*) Pretul nu contine TVA
cuTVA: 443.73 RON
Disponibilitate : Sunati
FT-80x10/100M WDM Media Converter Planet - FT-806B20

10/100Base-TX to 100Base-FX Bridge Media Converters, 1550nm Tx, 1310nm Rx

Pret : 227.60 RON
*) Pretul nu contine TVA
cuTVA: 270.85 RON
Disponibilitate : Sunati
FT-80x10/100M WDM Media Converter Planet - FT-806A20

Media converter de la singura fibra optica Single Mode cu viteza de 155Mbps ( tehnologie WDM single fiber) la retele Fast Ethernet pe cupru,
10/100Base-TX to 100Base-FX Bridge Media Converters, 1310nm Tx ( transmisie pe fibra) , 1550nm Rx ( receptie pe fibra);
Sursa de alimentare inclusa in pachet.

Pret : 222.76 RON
*) Pretul nu contine TVA
cuTVA: 265.08 RON
Disponibilitate : Sunati
GSD-604HP_fataSwitch POE 4 porturi Gigabit + 2 porturi Uplink Gigabit (55Wati) Planet - GSD-604HP

4-Port 10/100/1000T 802.3at PoE + 2-Port 10/100/1000T Desktop Switch (External 55 Watts)

Pret : 271.19 RON
*) Pretul nu contine TVA
cuTVA: 322.71 RON
Disponibilitate : In stoc
Pagina: 123456
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept