Curs valutar

17-Sep-2019

1 EURO = 4.7352 RON  
1 USD = 4.2979 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte

ANPC
Rezultatele cautarii pentru : planet - 105 inregistrari
Pagina: 123456
E2021-Port 802.3at PoE+ to 2-Port 802.3af/at Gigabit PoE Extender Planet - POE-E202

Injector/Repetor POE, 1 port 802.3at PoE+ la 2 porturi POE Gigabit 802.3af/at.

Pret : 241.50 RON
*) Pretul nu contine TVA
cuTVA: 287.38 RON
Disponibilitate : Sunati
GSD-1008HP8-Port 10/100/1000T 802.3at PoE + 2-Port 10/100/1000T Desktop Switch Planet - GSD-1008HP

PLANET GSD-1008HP provides eight 10/100/1000T ports featuring 30-watt 802.3at PoE+, a total 120-watt PoE budget and extra two uplink ports to fulfill the demand of sufficient PoE power for HD IP surveillance and Wi-Fi system in a small-scale but high-performance network. With the same desktop-sized and compact metal housing, it makes the placement of the unit convenient and provides a quick and easy PoE PDs deployment with power feeding.

Pret : 402.49 RON
*) Pretul nu contine TVA
cuTVA: 478.97 RON
Disponibilitate : Sunati
FSD-1008HP8-Port 10/100TX 802.3at PoE + 2-Port 10/100TX Desktop Switch Planet - FSD-1008HP

PLANET FSD-1008HP provides eight 10/100TX ports featuring 30-watt 802.3at PoE+, a total 120-watt PoE budget and extra two uplink ports to fulfill the demand of sufficient PoE power for HD IP surveillance and Wi-Fi system in a small-scale but high-performance network. With the same desktop-sized and compact metal housing, it makes the placement of the unit convenient and provides a quick and easy PoE PDs deployment with power feeding.

Pret : 355.14 RON
*) Pretul nu contine TVA
cuTVA: 422.62 RON
Disponibilitate : Sunati
24-Port 10/100/1000T 802.3at PoE + 2-Port 100/1000X SFP Managed SwitchSwitch Layer2, PoE 10/100/1000T 802.3at +2port SFP -24-Port Gigabit Planet - GS-4210-24P2S

 24-Port 10/100/1000T 802.3at PoE + 2-Port 100/1000X SFP Managed Switch

Pret : 1,586.29 RON
*) Pretul nu contine TVA
cuTVA: 1,887.69 RON
Disponibilitate : Sunati
MGB-Series TransceiverMGB-SFP Series Planet - MGB-Series Gigabit SFP

The MGB family of the SFP Gigabit Ethernet module can be installed into PLANET Switch and Media Converter products with 1000BASE-SX/LX/BX SFP interface. The deployment distance can be extended from 550m (Multi-Mode, LC) up to 120 kilometers (Single-mode, LC).

The SFP transceivers are hot-pluggable and hot-swappable. You can plug in and pull out the transceivers to / from any SFP port without having to power off the Switch/Media Converter.

Pret : La cerere
*) Pretul nu contine TVA
Disponibilitate : Sunati
FSD-604HP 4-Port 10/100TX 802.3af/at4-Port 10/100TX 802.3af/at PoE + 2-Port 10/100TX Desktop Switch Planet - FSD-604HP

PLANET FSD-604HP Desktop Switch provides four 802.3at PoE+ ports for catering to small-scale IP surveillance networks at a lower total cost. With dual 10/100BASE-TX uplink ports, the recorded HD video files from the 4 PoE IP cameras powered by the FSD-604HP are saved in the 4-channel NVR system.

Pret : 156.26 RON
*) Pretul nu contine TVA
cuTVA: 185.95 RON
Disponibilitate : In stoc
ISW800TSwitch Industrial 8-port 10/100Tx, carcasa metal compacta Planet - ISW-800T

Industrial 8-Port 10/100TX Compact Ethernet Switch

Pret : 260.44 RON
*) Pretul nu contine TVA
cuTVA: 309.92 RON
Disponibilitate : Sunati
ISW500TSwitch Industrial 5-port 10/100Tx, carcasa metal compacta Planet - ISW-500T

Industrial 5-Port 10/100TX Compact Ethernet Switch

Pret : 232.02 RON
*) Pretul nu contine TVA
cuTVA: 276.11 RON
Disponibilitate : Sunati
603FSwitch 5 porturi Gigabit + 1 port SFP, metalic Planet - GSD - 603F

5 - Port 10/100/1000T +1 - Port 100/1000X SFP Gigabit Ethernet Switch , Metal (External Power)

Pret : 158.63 RON
*) Pretul nu contine TVA
cuTVA: 188.77 RON
Disponibilitate : Sunati
frontSwtich L2+ 24-Port 10/100/1000T Ultra PoE + 4-Port 10G SFP+ cu Management si LCD touch screen Planet - GS-5220-24UP4XV

L2+/L4 24-Port 10/100/1000T 802.3at PoE + 4-Port 10G SFP+ Managed Switch with Color LCD Touch Screen, Hardware Layer3 IPv4/IPv6 Static Routing (400W PoE Budget, ONVIF)

Pret : 3,665.04 RON
*) Pretul nu contine TVA
cuTVA: 4,361.40 RON
Disponibilitate : Sunati
GS-4210-16T2SGigabit Ethernet Switch Planet - GS-4210-16T2S

16-Port Layer 2 Managed Gigabit Ethernet Switch + 2 SFP Interfaces

 
Pret : 524.19 RON
*) Pretul nu contine TVA
cuTVA: 623.78 RON
Disponibilitate : Sunati
ISW-511TISW-511T/ISW-511TS Planet - ISW-511T

4-Port 10/100Base-TX + 1-Port 100Base-FX Industrial Ethernet Switch

Pret : 307.79 RON
*) Pretul nu contine TVA
cuTVA: 366.27 RON
Disponibilitate : Sunati
POE-172Single-Port 10/100/1000Mbps Ultra PoE Injector (60W) Planet - POE-172

PLANET POE-172 Ultra Power over Ethernet Injector provides a maximum of 60watt power and high-speed Ethernet data connection anywhere in your network infrastructure.

Pret : 170.47 RON
*) Pretul nu contine TVA
cuTVA: 202.86 RON
Disponibilitate : Sunati
POE-171SSingle-Port 10/100/1000Mbps Ultra PoE Splitter (12V/19V/24V) Planet - POE-171S

PoE Splitter -56V, tensiune iesire 12V; 9V; 24V
Receptor adaptor PoE, se conformeaza IEEE 802.3at/af, permite transfer de date si de energie pe acelasi cablu pana la 100m, carcasa plastic, format de buzunar, plug and play, RoHS:

Pret : 260.44 RON
*) Pretul nu contine TVA
cuTVA: 309.92 RON
Disponibilitate : Sunati
POE-171Single-Port 10/100/1000Mbps Ultra PoE Injector (60 Watts) Planet - POE-171

POE injector gigabit: 1 port PoE, se conformeaza IEEE 802.3at/af, permite transfer de date si de energie pe acelasi cablu pana la 100m, carcasa metal, format de buzunar, plug and play, RoHS.

Pret : 222.55 RON
*) Pretul nu contine TVA
cuTVA: 264.84 RON
Disponibilitate : Sunati
GSW-1222VUP8-Port Ultra PoE + 2-Port 10/100/1000T + 2-Port 1000X SFP Gigabit Ethernet Switch with LCD PoE Monitor Planet - GSW-1222VUP

8-Port 10/100/1000T Ultra PoE + 2-Port 10/100/1000T + 2-Port 1000X SFP Gigabit Ethernet Switch with LCD PoE Monitor / 380W

Pret : 1,325.86 RON
*) Pretul nu contine TVA
cuTVA: 1,577.77 RON
Disponibilitate : Sunati
IGS-5225-8P4SSwitch Industrial 8-Port 10/100/1000T 802.3at PoE+, 4-Port 100/1000X SFP Planet - IGS-5225-8P4S

Switch Industrial 8-Port 10/100/1000T 802.3at PoE+ , 4-Port 100/1000X SFP, (-40 ~ 75 °C)

Pret : 2,154.52 RON
*) Pretul nu contine TVA
cuTVA: 2,563.87 RON
Disponibilitate : Sunati
POE-151-EUIEEE 802.3af POE Injector (Mid-Span) Planet - POE-151-EU

IEEE 802.3af Power Over Ethernet Injector (Mid-Span)

Pret : 93.76 RON
*) Pretul nu contine TVA
cuTVA: 111.57 RON
Disponibilitate : Sunati
GSW-240124-Port 10/100/1000Mbps Gigabit Ethernet Switch Planet - GSW-2401

24-Port 10/100/1000Mbps Gigabit Ethernet Switch

Pret : 407.23 RON
*) Pretul nu contine TVA
cuTVA: 484.60 RON
Disponibilitate : Sunati
FNSW-480048-Port 10/100Mbps Fast Ethernet Switch Planet - FNSW-4800

48-Port 10/100Mbps Fast Ethernet Switch

Pret : 440.37 RON
*) Pretul nu contine TVA
cuTVA: 524.04 RON
Disponibilitate : Sunati
Pagina: 123456
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept