Curs valutar


1 EURO = 4.7792 RON  
1 USD = 4.2976 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:


» Opticum/Optibox


LNC cu feed pentru antene offset

LNC cu feed pentru antene offset Inverto Inverto-40TL+LNC cu feed pentru antene offset Inverto - Inverto-40TL+

LNB twin, forma L, zgomot 0,2 dB

Pret vechi 69.94 RON
Pret nou
60.77 RON
*) Pretul nu contine TVA
cuTVA: 72.32 RON
Disponibilitate : Sunati
LNC cu feed pentru antene offset Opticum ALPS-SingleLNC cu feed pentru antene offset Opticum - ALPS-Single

LNC SINGLE universal ALPS 10,7-12,75GHz, pentru offset, 0,3dB

Pret vechi 28.84 RON
Pret nou
17.51 RON
pret per bucata
*) Pretul nu contine TVA
cuTVA: 20.84 RON
Disponibilitate : Sunati

Monturi H-H

Montura H-H Optibox DM3800Montura H-H Amiko - DM3800

Montura H-H  pt. antene max.1,4m mecanism metalic, precizie ridicata, comanda cu DiSEqC 1.2 si 1.3

Pret vechi 204.97 RON
Pret nou
177.16 RON
*) Pretul nu contine TVA
cuTVA: 210.82 RON
Disponibilitate : Sunati

Receptoare de satelit digitale

Receptor de satelit digital Opticum 4100C FTAReceptor de satelit digital Opticum - Opticum 4100C FTA

Receptor de satelit Opticum 4000 canale, 1 SCART, 3 RCA, S/PDIF, LED Display, UHF Modulator

Pret vechi 97.85 RON
Pret nou
72.10 RON
*) Pretul nu contine TVA
cuTVA: 85.80 RON
Disponibilitate : Indisponibil
Receptor de satelit digital Globo GL-4000Receptor de satelit digital Globo - DIG4000A

Receptor de satelit Globo FTA, AV/RF Out, S/PDIF, 4000 ch., Display, RS-232 Sharing

Pret : 66.46 RON
*) Pretul nu contine TVA
cuTVA: 79.08 RON
Disponibilitate : Indisponibil

Receptoare de Satelit High Definition

Receptor de satelit HD Opticum HD 9600Receptor de satelit High Definition Opticum - 9600 HD

Receptor de satelit High Definition Opticum HD 9600, MPEG4 AVC/H.264, 2 sloturi CI, 2x Card Reader, SCART, S/PDIF, 1.2, IR connector, RS232, Ethernet

Pret vechi 567.53 RON
Pret nou
460.41 RON
*) Pretul nu contine TVA
cuTVA: 547.89 RON
Disponibilitate : Sunati
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept