Curs valutar

24-Feb-2020

1 EURO = 4.8024 RON  
1 USD = 4.4395 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavansfpcameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvipdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerindustrialplugprizaraspberry piaudiovideocable4 contactrcajackac routeramikounifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w

ANPC

Oferte speciale

Pagini produse: 123456789101112131415161718
YK03-5V/2.5A
24.73 RON
fara TVA
13.85 RON
pret fara TVA
cuTVA: 16.48 RON
YK03-5V3A
33.64 RON
fara TVA
16.82 RON
pret fara TVA
cuTVA: 20.01 RON
YK32-12V1.5A
17.81 RON
fara TVA
14.84 RON
pret fara TVA
cuTVA: 17.66 RON
YK01-5V2A
21.76 RON
fara TVA
11.38 RON
pret fara TVA
cuTVA: 13.54 RON
YK-76
24.49 RON
fara TVA
22.26 RON
pret fara TVA
cuTVA: 26.49 RON
Sursa alimentare DC12V 2000mA
21.76 RON
fara TVA
15.33 RON
pret fara TVA
cuTVA: 18.25 RON
81.37 RON
fara TVA
55.62 RON
pret fara TVA
cuTVA: 66.19 RON
LNC cu feed pentru antene offset Opticum ALPS-Single
28.84 RON
fara TVA
17.51 RON
pret per bucata
pret fara TVA
cuTVA: 20.84 RON
Receptor de satelit digital VU Plus Zero4 K
641.69 RON
fara TVA
602.55 RON
pret fara TVA
cuTVA: 717.03 RON
USB-RJ45
204.97 RON
fara TVA
132.87 RON
pret fara TVA
cuTVA: 158.12 RON
NF-903
242.38 RON
fara TVA
187.97 RON
pret fara TVA
cuTVA: 223.68 RON
AV6471A
11,020.74 RON
fara TVA
9,645.62 RON
pret fara TVA
cuTVA: 11,478.29 RON
Combo mini -keyboard & Touchpad & accu
81.37 RON
fara TVA
49.44 RON
pret fara TVA
cuTVA: 58.83 RON
HD8150
185.19 RON
fara TVA
174.07 RON
pret fara TVA
cuTVA: 207.14 RON
GT-LED-FL-003-200W-WW
301.73 RON
fara TVA
197.36 RON
pret fara TVA
cuTVA: 234.86 RON
GT-LED-FL-003-200W-PW
301.73 RON
fara TVA
197.36 RON
pret fara TVA
cuTVA: 234.86 RON
GT-LED-FL-003-100W-WW
197.86 RON
fara TVA
88.54 RON
pret fara TVA
cuTVA: 105.36 RON
GT-LED-FL-003-100W-PW
197.86 RON
fara TVA
88.54 RON
pret fara TVA
cuTVA: 105.36 RON
GT-LED-FL-003-50W-PW
112.78 RON
fara TVA
55.40 RON
pret fara TVA
cuTVA: 65.93 RON
GT-LED-FL-003-50W-PW
112.78 RON
fara TVA
55.40 RON
pret fara TVA
cuTVA: 65.93 RON
GT-LED-FL-003-30W-WW
67.77 RON
fara TVA
36.60 RON
pret fara TVA
cuTVA: 43.56 RON
GT-LED-FL-003-10W-WW
30.67 RON
fara TVA
17.81 RON
pret fara TVA
cuTVA: 21.19 RON
DS-7604NI-E1/4P/A
556.20 RON
fara TVA
444.96 RON
pret fara TVA
cuTVA: 529.50 RON
DS-7604NI-E1/A
379.04 RON
fara TVA
341.14 RON
pret fara TVA
cuTVA: 405.95 RON
G3210P
591.10 RON
fara TVA
430.34 RON
pret fara TVA
cuTVA: 512.11 RON
ULTIMO4K
2,599.72 RON
fara TVA
2,268.06 RON
pret fara TVA
cuTVA: 2,698.99 RON
Video Balun-Screw terminal
46.50 RON
fara TVA
34.38 RON
pret fara TVA
cuTVA: 40.91 RON
Balun pasiv 1 canal video
14.84 RON
fara TVA
8.41 RON
pret fara TVA
cuTVA: 10.01 RON

 
Pagini produse: 123456789101112131415161718
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept