Curs valutar


1 EURO = 4.7315 RON  
1 USD = 4.2103 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20km


Oferte speciale

Pagini produse: 1234567891011121314
LNC cu feed pentru antene offset Opticum ALPS-Single
28.00 RON
fara TVA
17.00 RON
pret per bucata
pret fara TVA
cuTVA: 20.23 RON
Receptor de satelit digital VU Plus Zero4 K
623.00 RON
fara TVA
585.00 RON
pret fara TVA
cuTVA: 696.15 RON
199.00 RON
fara TVA
129.00 RON
pret fara TVA
cuTVA: 153.51 RON
231.84 RON
fara TVA
179.80 RON
pret fara TVA
cuTVA: 213.96 RON
14,052.56 RON
fara TVA
12,647.30 RON
pret fara TVA
cuTVA: 15,050.29 RON
Combo mini -keyboard & Touchpad & accu
79.00 RON
fara TVA
48.00 RON
pret fara TVA
cuTVA: 57.12 RON
179.80 RON
fara TVA
169.00 RON
pret fara TVA
cuTVA: 201.11 RON
288.62 RON
fara TVA
188.79 RON
pret fara TVA
cuTVA: 224.66 RON
288.62 RON
fara TVA
188.79 RON
pret fara TVA
cuTVA: 224.66 RON
189.26 RON
fara TVA
84.69 RON
pret fara TVA
cuTVA: 100.79 RON
189.26 RON
fara TVA
84.69 RON
pret fara TVA
cuTVA: 100.79 RON
107.88 RON
fara TVA
52.99 RON
pret fara TVA
cuTVA: 63.06 RON
107.88 RON
fara TVA
52.99 RON
pret fara TVA
cuTVA: 63.06 RON
64.82 RON
fara TVA
35.01 RON
pret fara TVA
cuTVA: 41.67 RON
29.34 RON
fara TVA
17.03 RON
pret fara TVA
cuTVA: 20.27 RON
540.00 RON
fara TVA
432.00 RON
pret fara TVA
cuTVA: 514.08 RON
368.00 RON
fara TVA
331.20 RON
pret fara TVA
cuTVA: 394.13 RON
170.00 RON
fara TVA
115.00 RON
pret fara TVA
cuTVA: 136.85 RON
565.41 RON
fara TVA
411.64 RON
pret fara TVA
cuTVA: 489.85 RON
2,524.00 RON
fara TVA
2,202.00 RON
pret fara TVA
cuTVA: 2,620.38 RON
Video Balun-Screw terminal
44.48 RON
fara TVA
32.88 RON
pret fara TVA
cuTVA: 39.13 RON
27.92 RON
fara TVA
16.56 RON
pret fara TVA
cuTVA: 19.71 RON
Balun pasiv 1 canal video
14.19 RON
fara TVA
8.04 RON
pret fara TVA
cuTVA: 9.57 RON
410.00 RON
fara TVA
351.00 RON
pret fara TVA
cuTVA: 417.69 RON

Pagini produse: 1234567891011121314
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept