Curs valutar

03-Aug-2020

1 EURO = 4.8351 RON  
1 USD = 4.1131 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoegigabitcablu utpz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewayplugprizawirelessterouter wireless routerac routerraspberry piaudiovideocable4 contactrcajackamikounifiraspberry pi 2 model benergytkb4k3kmxsfpddmmountableantene 24ghz802.3atmeterraftsolo10gdoor phone720pcomutatormicro switchperetemountwdm1000mswitch poeinjectormobilamesh3000ventrtl8370-grconectorconectorirapidelectricdateelectriciraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfanextender3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4kseoutdoor650ups120060001000010kvausbepscentrala5ghzfemalegigaethernetmiraac1200om1svcstackingcoaxvflsmbgftp5baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2cablu ftpab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascablutvcamewradvr4ch150mmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gaming20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetallitatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin bgftp6bgftp6pebgutp5bgutp6bgutp3bgutp5pebgftp5pebgutp6lszhbgutp6pebgutp5lszhbgsf/utp5lsnhbgftp5lszhbgftp6lszhbgf/ftp6abgf/ftp6apebgftp6alszhtooless>qrg11>xtrg11cu-mxtrg6uxtrg6mxtrg11mxtprg11cupextrg11pvcxtrg6m/txtrg6/txtrg11m/txtrg6u100xtrg6lszhxtrg11/tbgrg6ubgrg6/tbgrg6mbgrg6m/tbgrg11mbgrg11m/tbgrg6lszhbgrg6/tlszh

ANPC

Oferte speciale

Pagini produse: 123456789101112131415161718
JDR6W
13.79 RON
fara TVA
9.02 RON
pret fara TVA
cuTVA: 10.73 RON
GU10-6W
12.31 RON
fara TVA
9.02 RON
pret fara TVA
cuTVA: 10.73 RON
B55
12.31 RON
fara TVA
9.76 RON
pret fara TVA
cuTVA: 11.61 RON
C30b
11.88 RON
fara TVA
9.44 RON
pret fara TVA
cuTVA: 11.24 RON
Bec led glob 7W- E27
27.77 RON
fara TVA
16.97 RON
pret fara TVA
cuTVA: 20.20 RON
Bec led glob 7W- E14
27.77 RON
fara TVA
16.97 RON
pret fara TVA
cuTVA: 20.20 RON
Bec led glob 5x1W- E27
22.17 RON
fara TVA
13.69 RON
pret fara TVA
cuTVA: 16.29 RON
Bec led glob 5x1W- E14
22.17 RON
fara TVA
13.69 RON
pret fara TVA
cuTVA: 16.29 RON
BG-X4ADH
1,697.44 RON
fara TVA
1,481.02 RON
pret fara TVA
cuTVA: 1,762.41 RON
BG-X9ADHS
3,181.64 RON
fara TVA
2,576.93 RON
pret fara TVA
cuTVA: 3,066.54 RON
IPC-9800ADH PLUS
2,000.86 RON
fara TVA
1,766.40 RON
pret fara TVA
cuTVA: 2,102.01 RON
IPC-3500 D
1,165.93 RON
fara TVA
676.85 RON
pret fara TVA
cuTVA: 805.46 RON
Raspberry Pi3
188.84 RON
fara TVA
153.83 RON
pret fara TVA
cuTVA: 183.06 RON
YK13-12V2,5A
36.42 RON
fara TVA
25.13 RON
pret fara TVA
cuTVA: 29.91 RON
BG-X7MADH
2,304.27 RON
fara TVA
2,092.10 RON
pret fara TVA
cuTVA: 2,489.59 RON
BG-2800 ADH
1,007.85 RON
fara TVA
637.60 RON
pret fara TVA
cuTVA: 758.75 RON
YK03-5V/2.5A
25.65 RON
fara TVA
14.37 RON
pret fara TVA
cuTVA: 17.09 RON
YK03-5V3A
34.88 RON
fara TVA
17.44 RON
pret fara TVA
cuTVA: 20.75 RON
YK32-12V1.5A
18.47 RON
fara TVA
15.39 RON
pret fara TVA
cuTVA: 18.31 RON
YK01-5V2A
22.57 RON
fara TVA
11.80 RON
pret fara TVA
cuTVA: 14.04 RON
YK-76
25.39 RON
fara TVA
23.08 RON
pret fara TVA
cuTVA: 27.47 RON
Sursa alimentare DC12V 2000mA
22.57 RON
fara TVA
15.90 RON
pret fara TVA
cuTVA: 18.92 RON
83.81 RON
fara TVA
57.29 RON
pret fara TVA
cuTVA: 68.17 RON
LNC cu feed pentru antene offset Opticum ALPS-Single
29.71 RON
fara TVA
18.04 RON
pret per bucata
pret fara TVA
cuTVA: 21.46 RON
Receptor de satelit digital VU Plus Zero4 K
660.94 RON
fara TVA
620.63 RON
pret fara TVA
cuTVA: 738.54 RON
USB-RJ45
211.12 RON
fara TVA
136.86 RON
pret fara TVA
cuTVA: 162.86 RON
NF-903
251.35 RON
fara TVA
194.92 RON
pret fara TVA
cuTVA: 231.96 RON
optic switch gigabit 4Port/ Bridge Media Converter  2port SFP 1.25G + 2*RJ45 gigabit
169.23 RON
fara TVA
130.55 RON
pret fara TVA
cuTVA: 155.35 RON
AV6471A
11,428.68 RON
fara TVA
10,002.64 RON
pret fara TVA
cuTVA: 11,903.14 RON
Combo mini -keyboard & Touchpad & accu
83.81 RON
fara TVA
50.92 RON
pret fara TVA
cuTVA: 60.60 RON
HD8150
190.75 RON
fara TVA
179.29 RON
pret fara TVA
cuTVA: 213.36 RON

 
Pagini produse: 123456789101112131415161718
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept