Curs valutar

20-Sep-2019

1 EURO = 4.7432 RON  
1 USD = 4.2921 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte

ANPC

Oferte speciale

Pagini produse: 1234567891011121314
CIGPLUG
1.87 RON
fara TVA
1.30 RON
pret fara TVA
cuTVA: 1.55 RON
6P2CTC15
2.40 RON
fara TVA
1.10 RON
pret fara TVA
cuTVA: 1.31 RON
GU10SKT
1.52 RON
fara TVA
1.19 RON
pret fara TVA
cuTVA: 1.41 RON
G50AP-6W-WW
12.00 RON
fara TVA
8.40 RON
pret fara TVA
cuTVA: 10.00 RON
BZ5
11.20 RON
fara TVA
8.90 RON
pret fara TVA
cuTVA: 10.59 RON
BZ3
8.00 RON
fara TVA
6.40 RON
pret fara TVA
cuTVA: 7.62 RON
GU10COB5W
18.00 RON
fara TVA
12.50 RON
pret fara TVA
cuTVA: 14.88 RON
JDR6W
13.00 RON
fara TVA
8.50 RON
pret fara TVA
cuTVA: 10.12 RON
GU10-6W
11.60 RON
fara TVA
8.50 RON
pret fara TVA
cuTVA: 10.12 RON
B55
11.60 RON
fara TVA
9.20 RON
pret fara TVA
cuTVA: 10.95 RON
C30b
11.20 RON
fara TVA
8.90 RON
pret fara TVA
cuTVA: 10.59 RON
Bec led glob 7W- E27
26.18 RON
fara TVA
16.00 RON
pret fara TVA
cuTVA: 19.04 RON
Bec led glob 7W- E14
26.18 RON
fara TVA
16.00 RON
pret fara TVA
cuTVA: 19.04 RON
Bec led glob 5x1W- E27
20.90 RON
fara TVA
12.90 RON
pret fara TVA
cuTVA: 15.35 RON
Bec led glob 5x1W- E14
20.90 RON
fara TVA
12.90 RON
pret fara TVA
cuTVA: 15.35 RON
BG-X4ADH
1,600.00 RON
fara TVA
1,396.00 RON
pret fara TVA
cuTVA: 1,661.24 RON
BG-X9ADHS
2,999.00 RON
fara TVA
2,429.00 RON
pret fara TVA
cuTVA: 2,890.51 RON
IPC-9800ADH PLUS
1,886.00 RON
fara TVA
1,665.00 RON
pret fara TVA
cuTVA: 1,981.35 RON
IPC-3500 D
1,099.00 RON
fara TVA
638.00 RON
pret fara TVA
cuTVA: 759.22 RON
Raspberry Pi3
178.00 RON
fara TVA
145.00 RON
pret fara TVA
cuTVA: 172.55 RON
YK13-12V2,5A
33.68 RON
fara TVA
23.24 RON
pret fara TVA
cuTVA: 27.66 RON
BG-X7MADH
2,172.00 RON
fara TVA
1,972.00 RON
pret fara TVA
cuTVA: 2,346.68 RON
BG-2800 ADH
950.00 RON
fara TVA
601.00 RON
pret fara TVA
cuTVA: 715.19 RON
YK03-5V/2.5A
23.72 RON
fara TVA
13.28 RON
pret fara TVA
cuTVA: 15.80 RON
YK03-5V3A
32.25 RON
fara TVA
16.13 RON
pret fara TVA
cuTVA: 19.19 RON
YK32-12V1.5A
17.08 RON
fara TVA
14.23 RON
pret fara TVA
cuTVA: 16.93 RON
YK01-5V2A
20.87 RON
fara TVA
10.91 RON
pret fara TVA
cuTVA: 12.98 RON
YK-76
23.48 RON
fara TVA
21.34 RON
pret fara TVA
cuTVA: 25.40 RON
Sursa alimentare DC12V 2000mA
20.87 RON
fara TVA
14.70 RON
pret fara TVA
cuTVA: 17.50 RON
79.00 RON
fara TVA
54.00 RON
pret fara TVA
cuTVA: 64.26 RON
LNC cu feed pentru antene offset Opticum ALPS-Single
28.00 RON
fara TVA
17.00 RON
pret per bucata
pret fara TVA
cuTVA: 20.23 RON
Receptor de satelit digital VU Plus Zero4 K
623.00 RON
fara TVA
585.00 RON
pret fara TVA
cuTVA: 696.15 RON

 
Pagini produse: 1234567891011121314
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept