Curs valutar

22-Apr-2019

1 EURO = 4.7607 RON  
1 USD = 4.2327 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzac routerenergywirelessraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5inverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgapatchtrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high quality

ANPC

Oferte speciale

Pagini produse: 1234567891011121314
Vu+ DVB-S2 tuner
163.00 RON
fara TVA
155.00 RON
pret fara TVA
TF7720
531.00 RON
fara TVA
250.00 RON
pret fara TVA
Carcasa neagra Raspberry Pi 2
32.20 RON
fara TVA
22.00 RON
pret fara TVA
Receptor de satelit digital High Definition Optibox Gekko HD
442.74 RON
fara TVA
254.00 RON
pret fara TVA
Receptor de satelit digital Optibox KOALA
470.00 RON
fara TVA
290.00 RON
pret fara TVA
Antena satelit offset OUBIX
51.79 RON
fara TVA
36.00 RON
pret fara TVA
Antena satelit offset OUBIX
68.27 RON
fara TVA
47.00 RON
pret fara TVA
Antene satelit offset OUBIX
211.00 RON
fara TVA
130.00 RON
pret fara TVA
Antena satelit offset 1.3m OUBIX
211.00 RON
fara TVA
130.00 RON
pret fara TVA
Montura H-H Optibox DM3800
199.00 RON
fara TVA
172.00 RON
pret fara TVA
Vu+ Solo SE V2
779.00 RON
fara TVA
432.00 RON
pret fara TVA
TE series
1,009.27 RON
fara TVA
856.93 RON
pret fara TVA
HDP-1100PT
841.00 RON
fara TVA
620.00 RON
pret fara TVA
GB303
454.00 RON
fara TVA
334.00 RON
pret fara TVA
GB-300
587.00 RON
fara TVA
404.00 RON
pret fara TVA
GB-700
605.00 RON
fara TVA
475.00 RON
pret fara TVA
AMS9x12
314.00 RON
fara TVA
296.00 RON
pret fara TVA
Amiko Mira WiFi
165.00 RON
fara TVA
129.00 RON
pret fara TVA

 
Pagini produse: 1234567891011121314
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept