Curs valutar


1 EURO = 4.7792 RON  
1 USD = 4.2976 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:


Oferte speciale

Pagini produse: 12345678910111213141516
Gigabit Gaming Router AC1200, 4 antennas
159.98 RON
fara TVA
142.75 RON
pret fara TVA
cuTVA: 169.88 RON
330.80 RON
fara TVA
285.51 RON
pret fara TVA
cuTVA: 339.76 RON
2,121.63 RON
fara TVA
1,673.68 RON
pret fara TVA
cuTVA: 1,991.67 RON
1.43 RON
fara TVA
1.18 RON
pret fara TVA
cuTVA: 1.40 RON
1,157.40 RON
fara TVA
984.52 RON
pret fara TVA
cuTVA: 1,171.57 RON
942.92 RON
fara TVA
802.38 RON
pret fara TVA
cuTVA: 954.83 RON
826.74 RON
fara TVA
699.01 RON
pret fara TVA
cuTVA: 831.82 RON
1,054.02 RON
fara TVA
895.91 RON
pret fara TVA
cuTVA: 1,066.13 RON
897.73 RON
fara TVA
763.00 RON
pret fara TVA
cuTVA: 907.97 RON
787.91 RON
fara TVA
669.47 RON
pret fara TVA
cuTVA: 796.67 RON
Range Extender Universal Wi-Fi 300Mbps
87.55 RON
fara TVA
72.10 RON
pret fara TVA
cuTVA: 85.80 RON
TE series
836.84 RON
fara TVA
738.39 RON
pret fara TVA
cuTVA: 878.68 RON
TE series
925.44 RON
fara TVA
812.23 RON
pret fara TVA
cuTVA: 966.55 RON
TE series
738.39 RON
fara TVA
674.39 RON
pret fara TVA
cuTVA: 802.53 RON
Antena 2,4GHz TP-Link TL-ANT2409A
51.50 RON
fara TVA
36.05 RON
pret fara TVA
cuTVA: 42.90 RON
191.98 RON
fara TVA
127.99 RON
pret fara TVA
cuTVA: 152.30 RON
Vu+ DVB-S2 tuner
167.89 RON
fara TVA
159.65 RON
pret fara TVA
cuTVA: 189.98 RON
546.93 RON
fara TVA
257.50 RON
pret fara TVA
cuTVA: 306.43 RON
233.81 RON
fara TVA
219.39 RON
pret fara TVA
cuTVA: 261.07 RON
Raspberry Pi 3 Model B
33.68 RON
fara TVA
29.87 RON
pret fara TVA
cuTVA: 35.55 RON
306.94 RON
fara TVA
225.57 RON
pret fara TVA
cuTVA: 268.43 RON
381.10 RON
fara TVA
307.97 RON
pret fara TVA
cuTVA: 366.48 RON
ML1200 Fata
216.30 RON
fara TVA
184.37 RON
pret fara TVA
cuTVA: 219.40 RON
236.90 RON
fara TVA
180.25 RON
pret fara TVA
cuTVA: 214.50 RON
Carcasa neagra Raspberry Pi 2
33.17 RON
fara TVA
22.66 RON
pret fara TVA
cuTVA: 26.97 RON
Receptor de satelit digital High Definition Optibox Gekko HD
456.02 RON
fara TVA
261.62 RON
pret fara TVA
cuTVA: 311.33 RON
Receptor de satelit digital Optibox KOALA
484.10 RON
fara TVA
298.70 RON
pret fara TVA
cuTVA: 355.45 RON
Antena satelit offset OUBIX
53.34 RON
fara TVA
37.08 RON
pret fara TVA
cuTVA: 44.13 RON
Antena satelit offset OUBIX
70.32 RON
fara TVA
48.41 RON
pret fara TVA
cuTVA: 57.61 RON
Antene satelit offset OUBIX
217.33 RON
fara TVA
133.90 RON
pret per bucata
pret fara TVA
cuTVA: 159.34 RON
Antena satelit offset 1.3m OUBIX
217.33 RON
fara TVA
133.90 RON
pret fara TVA
cuTVA: 159.34 RON

Pagini produse: 12345678910111213141516
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept