Curs valutar

10-Jul-2020

1 EURO = 4.8408 RON  
1 USD = 4.2716 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoegigabitcablu utpz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewayplugprizawirelessterouter wireless routerac routerraspberry piaudiovideocable4 contactrcajackamikounifiraspberry pi 2 model benergytkb4k3kmxsfpddmmountableantene 24ghz802.3atmeterraftsolo10gdoor phone720pcomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectriciraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbgftp5baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2cablu ftpab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascablutvcamewradvr4ch150mmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin bgftp6bgftp6pebgutp5bgutp6bgutp3bgutp5pebgftp5pebgutp6lszhbgutp6pebgutp5lszhbgsf/utp5lsnhbgftp5lszhbgftp6lszhbgf/ftp6abgf/ftp6apebgftp6alszh

ANPC

Oferte speciale

Pagini produse: 123456789101112131415161718
Archer C9
436.00 RON
fara TVA
450.00 RON
pret fara TVA
cuTVA: 535.50 RON
ISW-511T
338.86 RON
fara TVA
297.86 RON
pret fara TVA
cuTVA: 354.46 RON
NUTP6A
1.49 RON
fara TVA
1.23 RON
pret fara TVA
cuTVA: 1.46 RON
TE
1,099.64 RON
fara TVA
934.68 RON
pret fara TVA
cuTVA: 1,112.27 RON
TE
936.58 RON
fara TVA
796.02 RON
pret fara TVA
cuTVA: 947.26 RON
Antena 2,4GHz TP-Link TL-ANT2409A
53.05 RON
fara TVA
37.13 RON
pret fara TVA
cuTVA: 44.19 RON
HZS-300
200.29 RON
fara TVA
133.52 RON
pret fara TVA
cuTVA: 158.89 RON
Vu+ DVB-S2 tuner
172.93 RON
fara TVA
164.44 RON
pret fara TVA
cuTVA: 195.68 RON
TF7720
563.34 RON
fara TVA
265.23 RON
pret fara TVA
cuTVA: 315.62 RON
HD8265
240.82 RON
fara TVA
225.97 RON
pret fara TVA
cuTVA: 268.91 RON
Raspberry Pi 3 Model B
34.69 RON
fara TVA
30.77 RON
pret fara TVA
cuTVA: 36.61 RON
ML6200S
316.15 RON
fara TVA
232.34 RON
pret fara TVA
cuTVA: 276.48 RON
ML6500STC
392.53 RON
fara TVA
317.21 RON
pret fara TVA
cuTVA: 377.48 RON
ML1200 Fata
222.79 RON
fara TVA
189.90 RON
pret fara TVA
cuTVA: 225.98 RON
ML-4100T2C
244.01 RON
fara TVA
185.66 RON
pret fara TVA
cuTVA: 220.93 RON
Carcasa neagra Raspberry Pi 2
34.16 RON
fara TVA
23.34 RON
pret fara TVA
cuTVA: 27.77 RON
Receptor de satelit digital High Definition Optibox Gekko HD
469.70 RON
fara TVA
269.47 RON
pret fara TVA
cuTVA: 320.67 RON
Receptor de satelit digital Optibox KOALA
498.62 RON
fara TVA
307.66 RON
pret fara TVA
cuTVA: 366.12 RON
Antena satelit offset OUBIX
54.94 RON
fara TVA
38.19 RON
pret fara TVA
cuTVA: 45.45 RON
Antena satelit offset OUBIX
72.43 RON
fara TVA
49.86 RON
pret fara TVA
cuTVA: 59.34 RON
Antene satelit offset OUBIX
223.85 RON
fara TVA
137.92 RON
pret per bucata
pret fara TVA
cuTVA: 164.12 RON
Antena satelit offset 1.3m OUBIX
223.85 RON
fara TVA
137.92 RON
pret fara TVA
cuTVA: 164.12 RON
Montura H-H Optibox DM3800
211.12 RON
fara TVA
182.48 RON
pret fara TVA
cuTVA: 217.15 RON
Vu+ Solo SE V2
826.44 RON
fara TVA
458.31 RON
pret fara TVA
cuTVA: 545.39 RON
HDP-1100PT
892.22 RON
fara TVA
657.76 RON
pret fara TVA
cuTVA: 782.73 RON
GB303
481.65 RON
fara TVA
354.34 RON
pret fara TVA
cuTVA: 421.67 RON
GB-300
622.75 RON
fara TVA
428.60 RON
pret fara TVA
cuTVA: 510.04 RON
GB-700
641.85 RON
fara TVA
503.93 RON
pret fara TVA
cuTVA: 599.67 RON

 
Pagini produse: 123456789101112131415161718
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept