Curs valutar

01-Apr-2020

1 EURO = 4.8246 RON  
1 USD = 4.4133 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavansfpcameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvipdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerindustrialplugprizaraspberry piaudiovideocable4 contactrcajackac routeramikounifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9

ANPC

Oferte speciale

Pagini produse: 123456789101112131415161718
ISW-511T
333.94 RON
fara TVA
288.22 RON
pret fara TVA
cuTVA: 342.98 RON
front
2,141.78 RON
fara TVA
1,689.57 RON
pret fara TVA
cuTVA: 2,010.59 RON
NUTP6A
1.44 RON
fara TVA
1.19 RON
pret fara TVA
cuTVA: 1.42 RON
TE
834.60 RON
fara TVA
705.65 RON
pret fara TVA
cuTVA: 839.72 RON
TE
1,064.04 RON
fara TVA
904.42 RON
pret fara TVA
cuTVA: 1,076.26 RON
TE
906.26 RON
fara TVA
770.25 RON
pret fara TVA
cuTVA: 916.59 RON
Range Extender Universal Wi-Fi 300Mbps
71.00 RON
fara TVA
60.10 RON
pret fara TVA
cuTVA: 71.52 RON
TE series
934.24 RON
fara TVA
800.64 RON
pret fara TVA
cuTVA: 952.76 RON
Antena 2,4GHz TP-Link TL-ANT2409A
51.50 RON
fara TVA
36.05 RON
pret fara TVA
cuTVA: 42.90 RON
HZS-300
193.80 RON
fara TVA
129.20 RON
pret fara TVA
cuTVA: 153.75 RON
Vu+ DVB-S2 tuner
167.89 RON
fara TVA
159.65 RON
pret fara TVA
cuTVA: 189.98 RON
TF7720
546.93 RON
fara TVA
257.50 RON
pret fara TVA
cuTVA: 306.43 RON
HD8265
233.81 RON
fara TVA
219.39 RON
pret fara TVA
cuTVA: 261.07 RON
Raspberry Pi 3 Model B
33.68 RON
fara TVA
29.87 RON
pret fara TVA
cuTVA: 35.55 RON
ML6200S
306.94 RON
fara TVA
225.57 RON
pret fara TVA
cuTVA: 268.43 RON
ML6500STC
381.10 RON
fara TVA
307.97 RON
pret fara TVA
cuTVA: 366.48 RON
ML1200 Fata
216.30 RON
fara TVA
184.37 RON
pret fara TVA
cuTVA: 219.40 RON
ML-4100T2C
236.90 RON
fara TVA
180.25 RON
pret fara TVA
cuTVA: 214.50 RON
Carcasa neagra Raspberry Pi 2
33.17 RON
fara TVA
22.66 RON
pret fara TVA
cuTVA: 26.97 RON
Receptor de satelit digital High Definition Optibox Gekko HD
456.02 RON
fara TVA
261.62 RON
pret fara TVA
cuTVA: 311.33 RON
Receptor de satelit digital Optibox KOALA
484.10 RON
fara TVA
298.70 RON
pret fara TVA
cuTVA: 355.45 RON
Antena satelit offset OUBIX
53.34 RON
fara TVA
37.08 RON
pret fara TVA
cuTVA: 44.13 RON
Antena satelit offset OUBIX
70.32 RON
fara TVA
48.41 RON
pret fara TVA
cuTVA: 57.61 RON
Antene satelit offset OUBIX
217.33 RON
fara TVA
133.90 RON
pret per bucata
pret fara TVA
cuTVA: 159.34 RON
Antena satelit offset 1.3m OUBIX
217.33 RON
fara TVA
133.90 RON
pret fara TVA
cuTVA: 159.34 RON
Montura H-H Optibox DM3800
204.97 RON
fara TVA
177.16 RON
pret fara TVA
cuTVA: 210.82 RON
Vu+ Solo SE V2
802.37 RON
fara TVA
444.96 RON
pret fara TVA
cuTVA: 529.50 RON
HDP-1100PT
866.23 RON
fara TVA
638.60 RON
pret fara TVA
cuTVA: 759.93 RON
GB303
467.62 RON
fara TVA
344.02 RON
pret fara TVA
cuTVA: 409.38 RON

 
Pagini produse: 123456789101112131415161718
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept