Curs valutar

21-Aug-2019

1 EURO = 4.7305 RON  
1 USD = 4.2682 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvc

ANPC

Oferte speciale

Pagini produse: 1234567891011121314
front
157.00 RON
fara TVA
137.00 RON
pret per bucata
pret fara TVA
cuTVA: 163.03 RON
GSD-1002VHP
567.66 RON
fara TVA
468.32 RON
pret fara TVA
cuTVA: 557.30 RON
HZS-300
184.49 RON
fara TVA
122.99 RON
pret fara TVA
cuTVA: 146.36 RON
Vu+ DVB-S2 tuner
163.00 RON
fara TVA
155.00 RON
pret fara TVA
cuTVA: 184.45 RON
TF7720
531.00 RON
fara TVA
250.00 RON
pret fara TVA
cuTVA: 297.50 RON
HD8265
227.00 RON
fara TVA
213.00 RON
pret fara TVA
cuTVA: 253.47 RON
Raspberry Pi 3 Model B
32.70 RON
fara TVA
29.00 RON
pret fara TVA
cuTVA: 34.51 RON
ML6200S
298.00 RON
fara TVA
219.00 RON
pret fara TVA
cuTVA: 260.61 RON
ML6500STC
370.00 RON
fara TVA
299.00 RON
pret fara TVA
cuTVA: 355.81 RON
ML1200 Fata
210.00 RON
fara TVA
179.00 RON
pret fara TVA
cuTVA: 213.01 RON
Amiko 8250
241.00 RON
fara TVA
199.00 RON
pret fara TVA
cuTVA: 236.81 RON
ML-4100T2C
230.00 RON
fara TVA
175.00 RON
pret fara TVA
cuTVA: 208.25 RON
Carcasa neagra Raspberry Pi 2
32.20 RON
fara TVA
22.00 RON
pret fara TVA
cuTVA: 26.18 RON
Receptor de satelit digital High Definition Optibox Gekko HD
442.74 RON
fara TVA
254.00 RON
pret fara TVA
cuTVA: 302.26 RON
Receptor de satelit digital Optibox KOALA
470.00 RON
fara TVA
290.00 RON
pret fara TVA
cuTVA: 345.10 RON
Antena satelit offset OUBIX
51.79 RON
fara TVA
36.00 RON
pret fara TVA
cuTVA: 42.84 RON
Antena satelit offset OUBIX
68.27 RON
fara TVA
47.00 RON
pret fara TVA
cuTVA: 55.93 RON
Antene satelit offset OUBIX
211.00 RON
fara TVA
130.00 RON
pret per bucata
pret fara TVA
cuTVA: 154.70 RON
Antena satelit offset 1.3m OUBIX
211.00 RON
fara TVA
130.00 RON
pret fara TVA
cuTVA: 154.70 RON
Montura H-H Optibox DM3800
199.00 RON
fara TVA
172.00 RON
pret fara TVA
cuTVA: 204.68 RON
Vu+ Solo SE V2
779.00 RON
fara TVA
432.00 RON
pret fara TVA
cuTVA: 514.08 RON
TE series
1,002.87 RON
fara TVA
851.49 RON
pret fara TVA
cuTVA: 1,013.27 RON
HDP-1100PT
841.00 RON
fara TVA
620.00 RON
pret fara TVA
cuTVA: 737.80 RON
GB303
454.00 RON
fara TVA
334.00 RON
pret fara TVA
cuTVA: 397.46 RON
GB-300
587.00 RON
fara TVA
404.00 RON
pret fara TVA
cuTVA: 480.76 RON
GB-700
605.00 RON
fara TVA
475.00 RON
pret fara TVA
cuTVA: 565.25 RON
AMS9x12
314.00 RON
fara TVA
296.00 RON
pret fara TVA
cuTVA: 352.24 RON

 
Pagini produse: 1234567891011121314
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept