Curs valutar

20-Aug-2019

1 EURO = 4.7305 RON  
1 USD = 4.2682 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvc

ANPC
  • UPS Braun Group
  • Cyber Power
  • Cyber Power
  • TP-Link
  • IP-COM
  • Planet
  • NETIS
  • Cabluri Belden
  • IP-COM
  • IP-COM
Pagini produse: 123456789101112131415
BARE SILICON

10.00 RON
pret fara TVA
cuTVA: 11.90 RON
YH937D

99.00 RON
pret fara TVA
cuTVA: 117.81 RON
YH937BD+

170.00 RON
pret fara TVA
cuTVA: 202.30 RON
YH-908D

190.00 RON
pret fara TVA
cuTVA: 226.10 RON
Statie de lipit Atten AT938
167.93 RON
fara TVA
96.50 RON
pret fara TVA
cuTVA: 114.84 RON
YH8858

223.00 RON
pret fara TVA
cuTVA: 265.37 RON
usb to micro usb
5.00 RON
fara TVA
2.10 RON
pret fara TVA
cuTVA: 2.50 RON
usb-mini usb
6.00 RON
fara TVA
2.60 RON
pret fara TVA
cuTVA: 3.09 RON
DCMCRUSB

2.37 RON
pret fara TVA
cuTVA: 2.81 RON
Jow Connectors "I", "T" & "D" type

0.98 RON
pret fara TVA
cuTVA: 1.17 RON
ML7200

266.60 RON
pret fara TVA
cuTVA: 317.25 RON
Antena satelit offset OUBIX
68.27 RON
fara TVA
47.00 RON
pret fara TVA
cuTVA: 55.93 RON
Antene satelit offset OUBIX
211.00 RON
fara TVA
130.00 RON
pret per bucata
pret fara TVA
cuTVA: 154.70 RON
LNC cu feed pentru antene offset Opticum ALPS-Single
28.00 RON
fara TVA
17.00 RON
pret per bucata
pret fara TVA
cuTVA: 20.23 RON
SATTRACKER

319.00 RON
pret fara TVA
cuTVA: 379.61 RON
Receptor de satelit digital Globo GL-4000

64.52 RON
pret fara TVA
cuTVA: 76.78 RON
Vu+ DUO 4K

1,500.00 RON
pret fara TVA
cuTVA: 1,785.00 RON
TF7720
531.00 RON
fara TVA
250.00 RON
pret fara TVA
cuTVA: 297.50 RON
Pagini produse: 123456789101112131415

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept