Curs valutar

11-Dec-2019

1 EURO = 4.7787 RON  
1 USD = 4.3149 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlan

ANPC
  • UPS Braun Group
  • Cyber Power
  • Cyber Power
  • TP-Link
  • IP-COM
  • Planet
  • NETIS
  • Cabluri Belden
  • IP-COM
  • IP-COM

In lunile noiembrie si decembrie, din cauza supraaglomerarii firmelor de curierat, este posibil sa apara intarzieri de cateva zile in livrarea produselor comandate.

De asemenea curierii nu mai accepta colete ce depasesc 40 de kg iar in cazul coletelor voluminoase este posibil ca livrarea sa se efectueze doar prin ridicare de la sediul firmei de curierat - fara a mai fi livrate direct la client.


Pagini produse: 123456789101112131415
Receptor de satelit digital Globo GL-4000

66.46 RON
pret fara TVA
cuTVA: 79.08 RON
Vu+ DUO 4K

1,545.00 RON
pret fara TVA
cuTVA: 1,838.55 RON
TF7720
546.93 RON
fara TVA
257.50 RON
pret fara TVA
cuTVA: 306.43 RON
HD8265
233.81 RON
fara TVA
219.39 RON
pret fara TVA
cuTVA: 261.07 RON
Amiko Mira WiFi
169.95 RON
fara TVA
132.87 RON
pret fara TVA
cuTVA: 158.12 RON
Amiko Mira
154.50 RON
fara TVA
122.57 RON
pret fara TVA
cuTVA: 145.86 RON
Amiko A5 combo
533.54 RON
fara TVA
453.20 RON
pret fara TVA
cuTVA: 539.31 RON
Receptor Terestrial Amiko T60 T2

76.12 RON
pret fara TVA
cuTVA: 90.58 RON
VU Plus Uno 4K SE
1,385.35 RON
fara TVA
1,141.24 RON
pret fara TVA
cuTVA: 1,358.08 RON
Receptor de satelit digital VU Plus Zero4 K
641.69 RON
fara TVA
602.55 RON
pret fara TVA
cuTVA: 717.03 RON
AMIKO A4 COMBO
422.30 RON
fara TVA
361.53 RON
pret fara TVA
cuTVA: 430.22 RON
ML6200S
306.94 RON
fara TVA
225.57 RON
pret fara TVA
cuTVA: 268.43 RON
ML6500STC
381.10 RON
fara TVA
307.97 RON
pret fara TVA
cuTVA: 366.48 RON
Vu+ Solo SE V2
802.37 RON
fara TVA
444.96 RON
pret fara TVA
cuTVA: 529.50 RON
ML-1100S
184.37 RON
fara TVA
113.30 RON
pret fara TVA
cuTVA: 134.83 RON
Vu+ Solo4K
1,384.32 RON
fara TVA
1,296.77 RON
pret fara TVA
cuTVA: 1,543.16 RON
ML-4100T2C
236.90 RON
fara TVA
180.25 RON
pret fara TVA
cuTVA: 214.50 RON
USB-RJ45
204.97 RON
fara TVA
132.87 RON
pret fara TVA
cuTVA: 158.12 RON
VU+ Zero fata
468.65 RON
fara TVA
415.50 RON
pret fara TVA
cuTVA: 494.45 RON
Amiko Micro HD SE
168.92 RON
fara TVA
130.81 RON
pret fara TVA
cuTVA: 155.66 RON
Receptor de satelit digital High Definition Optibox Gekko HD
456.02 RON
fara TVA
261.62 RON
pret fara TVA
cuTVA: 311.33 RON
Receptor de satelit digital Optibox KOALA
484.10 RON
fara TVA
298.70 RON
pret fara TVA
cuTVA: 355.45 RON
7700HDCICX
818.85 RON
fara TVA
154.50 RON
pret fara TVA
cuTVA: 183.86 RON
Pagini produse: 123456789101112131415

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept