Curs valutar

04-Aug-2020

1 EURO = 4.8351 RON  
1 USD = 4.1131 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoegigabitcablu utpz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewayplugprizawirelessterouter wireless routerac routerraspberry piaudiovideocable4 contactrcajackamikounifiraspberry pi 2 model benergytkb4k3kmxsfpddmmountableantene 24ghz802.3atmeterraftsolo10gdoor phone720pcomutatormicro switchperetemountwdm1000mswitch poeinjectormobilamesh3000ventrtl8370-grconectorconectorirapidelectricdateelectriciraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfanextender3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4kseoutdoor650ups120060001000010kvausbepscentrala5ghzfemalegigaethernetmiraac1200om1svcstackingcoaxvflsmbgftp5baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2cablu ftpab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascablutvcamewradvr4ch150mmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gaming20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetallitatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin bgftp6bgftp6pebgutp5bgutp6bgutp3bgutp5pebgftp5pebgutp6lszhbgutp6pebgutp5lszhbgsf/utp5lsnhbgftp5lszhbgftp6lszhbgf/ftp6abgf/ftp6apebgftp6alszhtooless>qrg11>xtrg11cu-mxtrg6uxtrg6mxtrg11mxtprg11cupextrg11pvcxtrg6m/txtrg6/txtrg11m/txtrg6u100xtrg6lszhxtrg11/tbgrg6ubgrg6/tbgrg6mbgrg6m/tbgrg11mbgrg11m/tbgrg6lszhbgrg6/tlszh

ANPC
  • Comenzi online rapide
  • UPS Braun Group
  • TP-Link
  • IP-COM
  • Planet
  • NETIS
  • Cabluri Belden
  • IP-COM

ANUNT PENTRU TOTI CLIENTII - MASURI PROTECTIE impotriva CORONAVIRUS

  • Magazinele noastre sunt in continuare deschise pentru clienti, cu respectarea legilor si ordonantelor in vigoare.
  • Rugam clientii sa aiba masca, manusi si sa pastreze distanta de 2 metri.
    Multumim pentru intelegere.
 
Pagini produse: 12345
ML7200

282.84 RON
pret fara TVA
cuTVA: 336.57 RON
LNC cu feed pentru antene offset Opticum ALPS-Single
29.71 RON
fara TVA
18.04 RON
pret per bucata
pret fara TVA
cuTVA: 21.46 RON
Receptor Terestrial Amiko T60 T2

78.40 RON
pret fara TVA
cuTVA: 93.30 RON
SLP 1.7-2.5

109.27 RON
pret fara TVA
cuTVA: 130.03 RON
ML-145 MAG

143.22 RON
pret fara TVA
cuTVA: 170.43 RON
P-5000 PL LED

200.51 RON
pret fara TVA
cuTVA: 238.61 RON
P-2000 PL

182.48 RON
pret fara TVA
cuTVA: 217.15 RON
Antena mobila CB27MHz  cu montura magnetica
107.72 RON
fara TVA
92.33 RON
pret fara TVA
cuTVA: 109.87 RON
MT-460W10

430.73 RON
pret fara TVA
cuTVA: 512.56 RON
Set 2 buc Statii portabile PMR 446MHz Intek T40
102.59 RON
fara TVA
51.30 RON
pret fara TVA
cuTVA: 61.04 RON
Set 2 buc Statii portabile PMR 446MHz Intek T30
133.37 RON
fara TVA
51.30 RON
pret fara TVA
cuTVA: 61.04 RON
Statie Radio KIRISUN PT-617 VHF
559.12 RON
fara TVA
456.53 RON
pret fara TVA
cuTVA: 543.27 RON
QJ-1921

82.07 RON
pret fara TVA
cuTVA: 97.67 RON
QJ-1863

206.68 RON
pret fara TVA
cuTVA: 245.94 RON
3rcam to 3rcam
4.46 RON
fara TVA
1.95 RON
pret fara TVA
cuTVA: 2.32 RON
M58e

436.01 RON
pret fara TVA
cuTVA: 518.85 RON
usb to micro usb
5.30 RON
fara TVA
2.23 RON
pret fara TVA
cuTVA: 2.65 RON
MAG22inch full HD.jpg
424.36 RON
fara TVA
371.32 RON
pret fara TVA
cuTVA: 441.86 RON
Monitor LCD 19 Soleron 19W19S
275.83 RON
fara TVA
233.40 RON
pret fara TVA
cuTVA: 277.74 RON
Panou solar 250W

1,020.78 RON
pret fara TVA
cuTVA: 1,214.73 RON
GT-LED-FL-003-50W-PW
116.95 RON
fara TVA
57.45 RON
pret fara TVA
cuTVA: 68.37 RON
GT-LED-FL-003-30W-PW
70.27 RON
fara TVA
37.96 RON
pret fara TVA
cuTVA: 45.17 RON
GT-LED-FL-003-10W-PW
31.80 RON
fara TVA
18.47 RON
pret fara TVA
cuTVA: 21.97 RON
UGL-5W
92.33 RON
fara TVA
70.27 RON
pret fara TVA
cuTVA: 83.63 RON
Pagini produse: 12345

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept