Curs valutar

10-Jul-2020

1 EURO = 4.8408 RON  
1 USD = 4.2716 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoegigabitcablu utpz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewayplugprizawirelessterouter wireless routerac routerraspberry piaudiovideocable4 contactrcajackamikounifiraspberry pi 2 model benergytkb4k3kmxsfpddmmountableantene 24ghz802.3atmeterraftsolo10gdoor phone720pcomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectriciraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbgftp5baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2cablu ftpab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascablutvcamewradvr4ch150mmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin bgftp6bgftp6pebgutp5bgutp6bgutp3bgutp5pebgftp5pebgutp6lszhbgutp6pebgutp5lszhbgsf/utp5lsnhbgftp5lszhbgftp6lszhbgf/ftp6abgf/ftp6apebgftp6alszh

ANPC
  • Comenzi online rapide
  • UPS Braun Group
  • TP-Link
  • IP-COM
  • Planet
  • NETIS
  • Cabluri Belden
  • IP-COM

ANUNT PENTRU TOTI CLIENTII - MASURI PROTECTIE impotriva CORONAVIRUS

  • Magazinele noastre sunt in continuare deschise pentru clienti, cu respectarea legilor si ordonantelor in vigoare.
  • Rugam clientii sa aiba masca, manusi si sa pastreze distanta de 2 metri.
    Multumim pentru intelegere.
 
Pagini produse: 1234567
USB-RJ45
211.12 RON
fara TVA
136.86 RON
pret fara TVA
cuTVA: 162.86 RON
VU+ Zero fata
482.71 RON
fara TVA
427.97 RON
pret fara TVA
cuTVA: 509.28 RON
Amiko Micro HD SE
173.99 RON
fara TVA
134.73 RON
pret fara TVA
cuTVA: 160.33 RON
Receptor de satelit digital High Definition Optibox Gekko HD
469.70 RON
fara TVA
269.47 RON
pret fara TVA
cuTVA: 320.67 RON
Receptor de satelit digital Optibox KOALA
498.62 RON
fara TVA
307.66 RON
pret fara TVA
cuTVA: 366.12 RON
7700HDCICX
843.42 RON
fara TVA
159.14 RON
pret fara TVA
cuTVA: 189.37 RON
SLP 1.7-2.5

109.27 RON
pret fara TVA
cuTVA: 130.03 RON
P-800 PL

128.39 RON
pret fara TVA
cuTVA: 152.78 RON
ML-145 MAG

143.22 RON
pret fara TVA
cuTVA: 170.43 RON
P-5000 PL LED

200.51 RON
pret fara TVA
cuTVA: 238.61 RON
P-2000 PL

182.48 RON
pret fara TVA
cuTVA: 217.15 RON
Antena mobila CB27MHz  cu montura magnetica
107.85 RON
fara TVA
92.44 RON
pret fara TVA
cuTVA: 110.00 RON
Statie Radio HYT TM-600
616.27 RON
fara TVA
503.29 RON
pret fara TVA
cuTVA: 598.91 RON
MT-460W10

430.73 RON
pret fara TVA
cuTVA: 512.56 RON
T100WP

328.68 RON
pret fara TVA
cuTVA: 391.13 RON
Set 2 buc Statii portabile PMR 446MHz Intek T40
102.71 RON
fara TVA
51.36 RON
pret fara TVA
cuTVA: 61.11 RON
Set 2 buc Statii portabile PMR 446MHz Intek T30
133.53 RON
fara TVA
51.36 RON
pret fara TVA
cuTVA: 61.11 RON
Statie Radio KIRISUN PT-617 VHF
559.78 RON
fara TVA
457.07 RON
pret fara TVA
cuTVA: 543.91 RON
QJ-1921

82.17 RON
pret fara TVA
cuTVA: 97.78 RON
QJ-1863

206.92 RON
pret fara TVA
cuTVA: 246.23 RON
3rcam to 3rcam
4.46 RON
fara TVA
1.95 RON
pret fara TVA
cuTVA: 2.32 RON
M58e

436.53 RON
pret fara TVA
cuTVA: 519.47 RON
usb to micro usb
5.30 RON
fara TVA
2.23 RON
pret fara TVA
cuTVA: 2.65 RON
MAG22inch full HD.jpg
424.36 RON
fara TVA
371.32 RON
pret fara TVA
cuTVA: 441.86 RON
Pagini produse: 1234567

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept