Curs valutar

18-Aug-2019

1 EURO = 4.7274 RON  
1 USD = 4.2656 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvc

ANPC
  • UPS Braun Group
  • Cyber Power
  • Cyber Power
  • TP-Link
  • IP-COM
  • Planet
  • NETIS
  • Cabluri Belden
  • IP-COM
  • IP-COM
Pagini produse: 123456789101112131415
AMIKO A4 COMBO
410.00 RON
fara TVA
351.00 RON
pret fara TVA
cuTVA: 417.69 RON
ML6200S
298.00 RON
fara TVA
219.00 RON
pret fara TVA
cuTVA: 260.61 RON
ML6500STC
370.00 RON
fara TVA
299.00 RON
pret fara TVA
cuTVA: 355.81 RON
Vu+ Solo SE V2
779.00 RON
fara TVA
432.00 RON
pret fara TVA
cuTVA: 514.08 RON
ML-1100S
179.00 RON
fara TVA
110.00 RON
pret fara TVA
cuTVA: 130.90 RON
Vu+ Solo4K
1,344.00 RON
fara TVA
1,259.00 RON
pret fara TVA
cuTVA: 1,498.21 RON
ML-4100T2C
230.00 RON
fara TVA
175.00 RON
pret fara TVA
cuTVA: 208.25 RON
USB-RJ45
199.00 RON
fara TVA
129.00 RON
pret fara TVA
cuTVA: 153.51 RON
VU+ Zero fata
455.00 RON
fara TVA
403.40 RON
pret fara TVA
cuTVA: 480.05 RON
Amiko Micro HD SE
164.00 RON
fara TVA
127.00 RON
pret fara TVA
cuTVA: 151.13 RON
Receptor de satelit digital High Definition Optibox Gekko HD
442.74 RON
fara TVA
254.00 RON
pret fara TVA
cuTVA: 302.26 RON
Receptor de satelit digital Optibox KOALA
470.00 RON
fara TVA
290.00 RON
pret fara TVA
cuTVA: 345.10 RON
7700HDCICX
795.00 RON
fara TVA
150.00 RON
pret fara TVA
cuTVA: 178.50 RON
SLP 1.7-2.5

103.00 RON
pret fara TVA
cuTVA: 122.57 RON
P-800 PL

118.19 RON
pret fara TVA
cuTVA: 140.64 RON
ML-145 MAG

135.00 RON
pret fara TVA
cuTVA: 160.65 RON
P-5000 PL LED

189.00 RON
pret fara TVA
cuTVA: 224.91 RON
P-2000 PL

172.00 RON
pret fara TVA
cuTVA: 204.68 RON
Antena mobila CB27MHz  cu montura magnetica
99.28 RON
fara TVA
85.09 RON
pret fara TVA
cuTVA: 101.26 RON
Statie Radio HYT TM-600
567.29 RON
fara TVA
463.29 RON
pret fara TVA
cuTVA: 551.31 RON
Intek M-899 VOX Safe drive radio CB 27MHz
305.00 RON
fara TVA
250.00 RON
pret fara TVA
cuTVA: 297.50 RON
MT-460W10

406.00 RON
pret fara TVA
cuTVA: 483.14 RON
T100WP

302.55 RON
pret fara TVA
cuTVA: 360.04 RON
Set 2 buc Statii portabile PMR 446MHz Intek T40
94.55 RON
fara TVA
56.73 RON
pret fara TVA
cuTVA: 67.51 RON
Pagini produse: 123456789101112131415

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept