Curs valutar

23-Apr-2019

1 EURO = 4.7581 RON  
1 USD = 4.2268 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzac routerenergywirelessraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5inverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgapatchtrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high quality

ANPC
  • UPS Braun Group
  • Cyber Power
  • Cyber Power
  • TP-Link
  • IP-COM
  • Planet
  • NETIS
  • Cabluri Belden
  • IP-COM
  • IP-COM
Pagini produse: 123456789101112131415
Receptor de satelit digital High Definition Optibox Gekko HD
442.74 RON
fara TVA
254.00 RON
pret fara TVA
Receptor de satelit digital Optibox KOALA
470.00 RON
fara TVA
290.00 RON
pret fara TVA
7700HDCICX
795.00 RON
fara TVA
150.00 RON
pret fara TVA
Antena mobila CB27MHz  cu montura magnetica
99.92 RON
fara TVA
85.65 RON
pret fara TVA
Intek M-899 VOX Safe drive radio CB 27MHz
305.00 RON
fara TVA
250.00 RON
pret fara TVA
Set 2 buc Statii portabile PMR 446MHz Intek T40
95.16 RON
fara TVA
57.10 RON
pret fara TVA
Set 2 buc Statii portabile PMR 446MHz Intek T30
123.71 RON
fara TVA
71.37 RON
pret fara TVA
Statie Radio KIRISUN PT-617 VHF
518.63 RON
fara TVA
423.47 RON
pret fara TVA
scart - scart
12.00 RON
fara TVA
2.60 RON
pret fara TVA
Pagini produse: 123456789101112131415

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept