Curs valutar

21-Jan-2020

1 EURO = 4.7790 RON  
1 USD = 4.3042 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:

ANPC
  • UPS Braun Group
  • Cyber Power
  • Cyber Power
  • TP-Link
  • IP-COM
  • Planet
  • NETIS
  • Cabluri Belden
  • IP-COM
  • IP-COM
Pagini produse: 123456789101112131415
Receptor Terestrial Amiko T60 T2

76.12 RON
pret fara TVA
cuTVA: 90.58 RON
VU Plus Uno 4K SE
1,385.35 RON
fara TVA
1,141.24 RON
pret fara TVA
cuTVA: 1,358.08 RON
Receptor de satelit digital VU Plus Zero4 K
641.69 RON
fara TVA
602.55 RON
pret fara TVA
cuTVA: 717.03 RON
AMIKO A4 COMBO
422.30 RON
fara TVA
361.53 RON
pret fara TVA
cuTVA: 430.22 RON
ML6200S
306.94 RON
fara TVA
225.57 RON
pret fara TVA
cuTVA: 268.43 RON
ML6500STC
381.10 RON
fara TVA
307.97 RON
pret fara TVA
cuTVA: 366.48 RON
Vu+ Solo SE V2
802.37 RON
fara TVA
444.96 RON
pret fara TVA
cuTVA: 529.50 RON
ML-1100S
184.37 RON
fara TVA
113.30 RON
pret fara TVA
cuTVA: 134.83 RON
Vu+ Solo4K
1,384.32 RON
fara TVA
1,296.77 RON
pret fara TVA
cuTVA: 1,543.16 RON
ML-4100T2C
236.90 RON
fara TVA
180.25 RON
pret fara TVA
cuTVA: 214.50 RON
USB-RJ45
204.97 RON
fara TVA
132.87 RON
pret fara TVA
cuTVA: 158.12 RON
VU+ Zero fata
468.65 RON
fara TVA
415.50 RON
pret fara TVA
cuTVA: 494.45 RON
Amiko Micro HD SE
168.92 RON
fara TVA
130.81 RON
pret fara TVA
cuTVA: 155.66 RON
Receptor de satelit digital High Definition Optibox Gekko HD
456.02 RON
fara TVA
261.62 RON
pret fara TVA
cuTVA: 311.33 RON
Receptor de satelit digital Optibox KOALA
484.10 RON
fara TVA
298.70 RON
pret fara TVA
cuTVA: 355.45 RON
7700HDCICX
818.85 RON
fara TVA
154.50 RON
pret fara TVA
cuTVA: 183.86 RON
SLP 1.7-2.5

106.09 RON
pret fara TVA
cuTVA: 126.25 RON
P-800 PL

123.06 RON
pret fara TVA
cuTVA: 146.44 RON
ML-145 MAG

139.05 RON
pret fara TVA
cuTVA: 165.47 RON
P-5000 PL LED

194.67 RON
pret fara TVA
cuTVA: 231.66 RON
P-2000 PL

177.16 RON
pret fara TVA
cuTVA: 210.82 RON
Antena mobila CB27MHz  cu montura magnetica
103.37 RON
fara TVA
88.60 RON
pret fara TVA
cuTVA: 105.44 RON
Statie Radio HYT TM-600
590.68 RON
fara TVA
482.39 RON
pret fara TVA
cuTVA: 574.05 RON
Intek M-899 VOX Safe drive radio CB 27MHz
314.15 RON
fara TVA
257.50 RON
pret fara TVA
cuTVA: 306.43 RON
Pagini produse: 123456789101112131415

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept