Curs valutar

23-Apr-2019

1 EURO = 4.7581 RON  
1 USD = 4.2268 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzac routerenergywirelessraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5inverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgapatchtrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high quality

ANPC
  • UPS Braun Group
  • Cyber Power
  • Cyber Power
  • TP-Link
  • IP-COM
  • Planet
  • NETIS
  • Cabluri Belden
  • IP-COM
  • IP-COM
Pagini produse: 123456789101112131415
Antene satelit offset OUBIX
211.00 RON
fara TVA
130.00 RON
pret fara TVA
LNC cu feed pentru antene offset Opticum ALPS-Single
28.00 RON
fara TVA
17.00 RON
pret fara TVA
TF7720
531.00 RON
fara TVA
250.00 RON
pret fara TVA
Amiko Mira WiFi
165.00 RON
fara TVA
129.00 RON
pret fara TVA
Amiko Mira
150.00 RON
fara TVA
119.00 RON
pret fara TVA
Amiko A5 combo
518.00 RON
fara TVA
440.00 RON
pret fara TVA
VU Plus Uno 4K SE
1,345.00 RON
fara TVA
1,108.00 RON
pret fara TVA
Receptor de satelit digital VU Plus Zero4 K
588.00 RON
fara TVA
554.60 RON
pret fara TVA
AMIKO A4 COMBO
410.00 RON
fara TVA
351.00 RON
pret fara TVA
Vu+ Solo SE V2
779.00 RON
fara TVA
432.00 RON
pret fara TVA
ML-1100S
179.00 RON
fara TVA
110.00 RON
pret fara TVA
Vu+ Solo4K
1,344.00 RON
fara TVA
1,259.00 RON
pret fara TVA
VU+ Zero fata
455.00 RON
fara TVA
403.40 RON
pret fara TVA
Pagini produse: 123456789101112131415

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept