Curs valutar

10-Apr-2020

1 EURO = 4.8278 RON  
1 USD = 4.4355 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavansfpcameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvipdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerindustrialplugprizaraspberry piaudiovideocable4 contactrcajackac routeramikounifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9

ANPC

Lichidari stocuri

Pagini produse: 12345678
Dulap Rack 42-unitati Braun Group EB 6642
2,202.38 RON
fara TVA
1,392.34 RON
pret fara TVA
cuTVA: 1,656.88 RON
Reflectometru/powermetru Performer LTS-102X
271.46 RON
fara TVA
213.82 RON
pret fara TVA
cuTVA: 254.45 RON
Reflectometru-powermetru Performer DF2476
240.73 RON
fara TVA
119.34 RON
pret fara TVA
cuTVA: 142.02 RON
Reflectometru-powermetru Performer DF2475
194.63 RON
fara TVA
84.53 RON
pret fara TVA
cuTVA: 100.60 RON
AC50
199.45 RON
fara TVA
142.14 RON
pret fara TVA
cuTVA: 169.15 RON
4 Channel Hybrid DVR_front
337.53 RON
fara TVA
204.87 RON
pret fara TVA
cuTVA: 243.80 RON
CAP1200_f
498.62 RON
fara TVA
371.32 RON
pret fara TVA
cuTVA: 441.86 RON
CAP300
231.06 RON
fara TVA
164.44 RON
pret fara TVA
cuTVA: 195.68 RON
CAP1750
647.15 RON
fara TVA
477.41 RON
pret fara TVA
cuTVA: 568.11 RON
Switch 16-port 1-port gigabit rackmount TP-Link TL-SL1117
155.95 RON
fara TVA
120.94 RON
pret fara TVA
cuTVA: 143.92 RON
EAP320
583.50 RON
fara TVA
456.19 RON
pret fara TVA
cuTVA: 542.86 RON
HZS-532E-DE
230.48 RON
fara TVA
189.51 RON
pret fara TVA
cuTVA: 225.51 RON
HZS-100
153.14 RON
fara TVA
121.39 RON
pret fara TVA
cuTVA: 144.45 RON
HAC-1000
793.88 RON
fara TVA
660.71 RON
pret fara TVA
cuTVA: 786.25 RON
QH-D7016C
586.68 RON
fara TVA
265.23 RON
pret fara TVA
cuTVA: 315.62 RON
QH-D6008CM
272.65 RON
fara TVA
190.96 RON
pret fara TVA
cuTVA: 227.24 RON
QH-D7108CM
577.13 RON
fara TVA
324.64 RON
pret fara TVA
cuTVA: 386.32 RON
DVR Standalone H.264 4 canale
604.71 RON
fara TVA
159.14 RON
pret fara TVA
cuTVA: 189.37 RON
Receptor digital terestru HD Strong SRT-8110
248.99 RON
fara TVA
95.48 RON
pret fara TVA
cuTVA: 113.62 RON
7700HDCICX
843.42 RON
fara TVA
159.14 RON
pret fara TVA
cuTVA: 189.37 RON
DF-5442RN
214.30 RON
fara TVA
32.89 RON
pret fara TVA
cuTVA: 39.14 RON
CK20-CM7030-ICR
78.51 RON
fara TVA
33.74 RON
pret fara TVA
cuTVA: 40.15 RON
AHD-2173
206.88 RON
fara TVA
31.08 RON
pret fara TVA
cuTVA: 36.99 RON
PT Dome Controller
63.65 RON
fara TVA
10.50 RON
pret fara TVA
cuTVA: 12.50 RON
Camera supraveghere video cu infrarosu rezistenta la apa
241.89 RON
fara TVA
31.40 RON
pret fara TVA
cuTVA: 37.37 RON
Camera de supraveghere IP Pan/Tilt
230.48 RON
fara TVA
41.49 RON
pret fara TVA
cuTVA: 49.37 RON
Camera de supraveghere IP
358.53 RON
fara TVA
72.83 RON
pret fara TVA
cuTVA: 86.67 RON
Camera de supraveghere IP Wireless
516.79 RON
fara TVA
108.78 RON
pret fara TVA
cuTVA: 129.45 RON
Client wireless USB 150mbps TP-Link TL-WN722N
47.74 RON
fara TVA
24.40 RON
pret fara TVA
cuTVA: 29.04 RON
Placa de captura DVR Komida BK-V8008A
483.77 RON
fara TVA
116.70 RON
pret fara TVA
cuTVA: 138.87 RON
Placa de captura DVR Komida BK-9108A
306.60 RON
fara TVA
121.79 RON
pret fara TVA
cuTVA: 144.93 RON
Placa de captura DVR Komida BK-9108
468.92 RON
fara TVA
94.00 RON
pret fara TVA
cuTVA: 111.86 RON

 
Pagini produse: 12345678
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept