Curs valutar

16-Oct-2019

1 EURO = 4.7524 RON  
1 USD = 4.3164 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte

ANPC

Lichidari stocuri

Pagini produse: 12345678
4 Channel Hybrid DVR_front
313.18 RON
fara TVA
190.10 RON
pret fara TVA
cuTVA: 226.21 RON
Switch 16-port 1-port gigabit rackmount TP-Link TL-SL1117
147.00 RON
fara TVA
114.00 RON
pret fara TVA
cuTVA: 135.66 RON
EAP320
550.00 RON
fara TVA
430.00 RON
pret fara TVA
cuTVA: 511.70 RON
HZS-532E-DE
213.86 RON
fara TVA
175.84 RON
pret fara TVA
cuTVA: 209.25 RON
HZS-100
142.10 RON
fara TVA
112.63 RON
pret fara TVA
cuTVA: 134.03 RON
HAC-1000
736.62 RON
fara TVA
613.06 RON
pret fara TVA
cuTVA: 729.54 RON
Media Convertor Planet FT-802S15
190.10 RON
fara TVA
118.81 RON
pret fara TVA
cuTVA: 141.38 RON
Archer C2
160.00 RON
fara TVA
115.00 RON
pret fara TVA
cuTVA: 136.85 RON
QH-D7016C
553.00 RON
fara TVA
250.00 RON
pret fara TVA
cuTVA: 297.50 RON
QH-D6008CM
257.00 RON
fara TVA
180.00 RON
pret fara TVA
cuTVA: 214.20 RON
QH-D7108CM
544.00 RON
fara TVA
306.00 RON
pret fara TVA
cuTVA: 364.14 RON
DVR Standalone H.264 4 canale
570.00 RON
fara TVA
150.00 RON
pret fara TVA
cuTVA: 178.50 RON
Receptor digital terestru HD Strong SRT-8110
234.70 RON
fara TVA
90.00 RON
pret fara TVA
cuTVA: 107.10 RON
7700HDCICX
795.00 RON
fara TVA
150.00 RON
pret fara TVA
cuTVA: 178.50 RON
DF-5442RN
202.00 RON
fara TVA
31.00 RON
pret fara TVA
cuTVA: 36.89 RON
CK20-CM7030-ICR
74.00 RON
fara TVA
31.80 RON
pret fara TVA
cuTVA: 37.84 RON
AHD-2173
195.00 RON
fara TVA
29.30 RON
pret fara TVA
cuTVA: 34.87 RON
PT Dome Controller
60.00 RON
fara TVA
9.90 RON
pret fara TVA
cuTVA: 11.78 RON
Camera supraveghere video cu infrarosu rezistenta la apa
228.00 RON
fara TVA
29.60 RON
pret fara TVA
cuTVA: 35.22 RON
Camera de supraveghere IP Pan/Tilt
213.86 RON
fara TVA
38.49 RON
pret fara TVA
cuTVA: 45.81 RON
Camera de supraveghere IP
332.67 RON
fara TVA
67.58 RON
pret fara TVA
cuTVA: 80.42 RON
Camera de supraveghere IP Wireless
479.52 RON
fara TVA
100.94 RON
pret fara TVA
cuTVA: 120.12 RON
Client wireless USB 150mbps TP-Link TL-WN722N
45.00 RON
fara TVA
23.00 RON
pret fara TVA
cuTVA: 27.37 RON
Placa de captura DVR Komida BK-V8008A
456.00 RON
fara TVA
110.00 RON
pret fara TVA
cuTVA: 130.90 RON
Placa de captura DVR Komida BK-9108A
289.00 RON
fara TVA
114.80 RON
pret fara TVA
cuTVA: 136.61 RON
Placa de captura DVR Komida BK-9108
442.00 RON
fara TVA
88.60 RON
pret fara TVA
cuTVA: 105.43 RON
Placa de captura DVR Komida BK-9104A
349.00 RON
fara TVA
71.00 RON
pret fara TVA
cuTVA: 84.49 RON
Placa de captura DVR Komida BK-7108
303.00 RON
fara TVA
102.00 RON
pret fara TVA
cuTVA: 121.38 RON
BK-V8004
284.00 RON
fara TVA
78.00 RON
pret fara TVA
cuTVA: 92.82 RON
BZ50S-FL
143.00 RON
fara TVA
87.50 RON
pret fara TVA
cuTVA: 104.13 RON
BZ20S-FL
71.70 RON
fara TVA
44.10 RON
pret fara TVA
cuTVA: 52.48 RON
BZ10S-FL
52.30 RON
fara TVA
32.30 RON
pret fara TVA
cuTVA: 38.44 RON

 
Pagini produse: 12345678
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept