Curs valutar

23-Sep-2020

1 EURO = 4.8641 RON  
1 USD = 4.1529 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoegigabitcablu utpz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfac routergatewayplugprizawirelessterouter wireless routerraspberry piaudiovideocable4 contactrcajackamikounifiraspberry pi 2 model benergytkb4k3kmxsfpddmmountableantene 24ghz802.3atmeterraftsolo10gplc2plc4door phone720pcomutatormicro switchperetemountwdm1000mswitch poeinjectormobilamesh3000ventmanagementplc8rtl8370-grconectorconectorirapidelectricdateelectriciraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfanextender3g4grg6plc16router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4kseoutdoor650ups120060001000010kvausbepscentrala5ghzfemalegigaethernetmiraac1200om1svcstackingcoaxvflsmbgftp5plc8-absbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2cablu ftpab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascablutvcamewradvr4ch150mmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gaming20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetallitatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin bgftp6bgftp6pebgutp5bgutp6bgutp3bgutp5pebgftp5pebgutp6lszhbgutp6pebgutp5lszhbgsf/utp5lsnhbgftp5lszhbgftp6lszhbgf/ftp6abgf/ftp6apebgftp6alszhtooless>qrg11>xtrg11cu-mxtrg6uxtrg6mxtrg11mxtprg11cupextrg11pvcxtrg6m/txtrg6/txtrg11m/txtrg6u100xtrg6lszhxtrg11/tbgrg6ubgrg6/tbgrg6mbgrg6m/tbgrg11mbgrg11m/tbgrg6lszhbgrg6/tlszh802.3btplc4-absplc16apcbgkutp5bgkutp5pbgkutp5pem>bgkftp5>bgkftp5pem

ANPC

Lichidari stocuri

Pagini produse: 12345678
Patch panel optic ODF 2U Braun Group GB-B-24-SC-APC
200.00 RON
fara TVA
100.00 RON
pret fara TVA
cuTVA: 119.00 RON
Patch panel optic ODF 2U Braun Group GB-B-24 SC-PC
180.00 RON
fara TVA
90.00 RON
pret fara TVA
cuTVA: 107.10 RON
WDAP-702C
748.25 RON
fara TVA
666.38 RON
pret fara TVA
cuTVA: 792.99 RON
Switch PoE 802.3at Desktop 8 porturi 10/100mbps
389.13 RON
fara TVA
340.49 RON
pret fara TVA
cuTVA: 405.18 RON
Dulap Rack 42-unitati Braun Group EB 6642
2,218.94 RON
fara TVA
1,402.81 RON
pret fara TVA
cuTVA: 1,669.34 RON
Reflectometru/powermetru Performer LTS-102X
273.50 RON
fara TVA
215.43 RON
pret fara TVA
cuTVA: 256.36 RON
Reflectometru-powermetru Performer DF2476
242.54 RON
fara TVA
120.24 RON
pret fara TVA
cuTVA: 143.09 RON
Reflectometru-powermetru Performer DF2475
196.09 RON
fara TVA
85.17 RON
pret fara TVA
cuTVA: 101.35 RON
AC50
199.45 RON
fara TVA
142.14 RON
pret fara TVA
cuTVA: 169.15 RON
4 Channel Hybrid DVR_front
340.07 RON
fara TVA
206.41 RON
pret fara TVA
cuTVA: 245.63 RON
CAP1200_f
498.62 RON
fara TVA
371.32 RON
pret fara TVA
cuTVA: 441.86 RON
CAP300
231.06 RON
fara TVA
164.44 RON
pret fara TVA
cuTVA: 195.68 RON
CAP1750
647.15 RON
fara TVA
477.41 RON
pret fara TVA
cuTVA: 568.11 RON
Switch 16-port 1-port gigabit rackmount TP-Link TL-SL1117
155.95 RON
fara TVA
120.94 RON
pret fara TVA
cuTVA: 143.92 RON
EAP320
583.50 RON
fara TVA
456.19 RON
pret fara TVA
cuTVA: 542.86 RON
HZS-532E-DE
232.21 RON
fara TVA
190.93 RON
pret fara TVA
cuTVA: 227.21 RON
HZS-100
154.29 RON
fara TVA
122.30 RON
pret fara TVA
cuTVA: 145.53 RON
HAC-1000
799.85 RON
fara TVA
665.68 RON
pret fara TVA
cuTVA: 792.16 RON
QH-D7016C
586.68 RON
fara TVA
265.23 RON
pret fara TVA
cuTVA: 315.62 RON
QH-D7108CM
577.13 RON
fara TVA
324.64 RON
pret fara TVA
cuTVA: 386.32 RON
DVR Standalone H.264 4 canale
604.71 RON
fara TVA
159.14 RON
pret fara TVA
cuTVA: 189.37 RON
Receptor digital terestru HD Strong SRT-8110
248.99 RON
fara TVA
95.48 RON
pret fara TVA
cuTVA: 113.62 RON
7700HDCICX
843.42 RON
fara TVA
159.14 RON
pret fara TVA
cuTVA: 189.37 RON
DF-5442RN
214.30 RON
fara TVA
32.89 RON
pret fara TVA
cuTVA: 39.14 RON
PT Dome Controller
63.65 RON
fara TVA
10.50 RON
pret fara TVA
cuTVA: 12.50 RON
Camera supraveghere video cu infrarosu rezistenta la apa
241.89 RON
fara TVA
31.40 RON
pret fara TVA
cuTVA: 37.37 RON
Camera de supraveghere IP Pan/Tilt
232.21 RON
fara TVA
41.80 RON
pret fara TVA
cuTVA: 49.74 RON
Camera de supraveghere IP
361.22 RON
fara TVA
73.38 RON
pret fara TVA
cuTVA: 87.32 RON
Camera de supraveghere IP Wireless
520.68 RON
fara TVA
109.60 RON
pret fara TVA
cuTVA: 130.43 RON
Client wireless USB 150mbps TP-Link TL-WN722N
42.00 RON
fara TVA
24.40 RON
pret fara TVA
cuTVA: 29.04 RON
Placa de captura DVR Komida BK-V8008A
483.77 RON
fara TVA
116.70 RON
pret fara TVA
cuTVA: 138.87 RON
Placa de captura DVR Komida BK-9108A
306.60 RON
fara TVA
121.79 RON
pret fara TVA
cuTVA: 144.93 RON

 
Pagini produse: 12345678
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept