Curs valutar

16-Dec-2019

1 EURO = 4.7786 RON  
1 USD = 4.2746 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlan

ANPC

Lichidari stocuri

Pagini produse: 12345678
4 Channel Hybrid DVR_front
324.36 RON
fara TVA
196.88 RON
pret fara TVA
cuTVA: 234.29 RON
CAP300_o_f
245.14 RON
fara TVA
175.10 RON
pret fara TVA
cuTVA: 208.37 RON
CAP1200_f
484.10 RON
fara TVA
360.50 RON
pret fara TVA
cuTVA: 429.00 RON
CAP300
224.33 RON
fara TVA
159.65 RON
pret fara TVA
cuTVA: 189.98 RON
CAP1750
628.30 RON
fara TVA
463.50 RON
pret fara TVA
cuTVA: 551.57 RON
Switch 16-port 1-port gigabit rackmount TP-Link TL-SL1117
151.41 RON
fara TVA
117.42 RON
pret fara TVA
cuTVA: 139.73 RON
EAP320
566.50 RON
fara TVA
442.90 RON
pret fara TVA
cuTVA: 527.05 RON
HZS-532E-DE
221.49 RON
fara TVA
182.11 RON
pret fara TVA
cuTVA: 216.71 RON
HZS-100
147.17 RON
fara TVA
116.65 RON
pret fara TVA
cuTVA: 138.81 RON
HAC-1000
762.90 RON
fara TVA
634.93 RON
pret fara TVA
cuTVA: 755.57 RON
Archer C2
164.80 RON
fara TVA
118.45 RON
pret fara TVA
cuTVA: 140.96 RON
QH-D7016C
569.59 RON
fara TVA
257.50 RON
pret fara TVA
cuTVA: 306.43 RON
QH-D6008CM
264.71 RON
fara TVA
185.40 RON
pret fara TVA
cuTVA: 220.63 RON
QH-D7108CM
560.32 RON
fara TVA
315.18 RON
pret fara TVA
cuTVA: 375.06 RON
DVR Standalone H.264 4 canale
587.10 RON
fara TVA
154.50 RON
pret fara TVA
cuTVA: 183.86 RON
Receptor digital terestru HD Strong SRT-8110
241.74 RON
fara TVA
92.70 RON
pret fara TVA
cuTVA: 110.31 RON
7700HDCICX
818.85 RON
fara TVA
154.50 RON
pret fara TVA
cuTVA: 183.86 RON
DF-5442RN
208.06 RON
fara TVA
31.93 RON
pret fara TVA
cuTVA: 38.00 RON
CK20-CM7030-ICR
76.22 RON
fara TVA
32.75 RON
pret fara TVA
cuTVA: 38.98 RON
AHD-2173
200.85 RON
fara TVA
30.18 RON
pret fara TVA
cuTVA: 35.91 RON
PT Dome Controller
61.80 RON
fara TVA
10.20 RON
pret fara TVA
cuTVA: 12.13 RON
Camera supraveghere video cu infrarosu rezistenta la apa
234.84 RON
fara TVA
30.49 RON
pret fara TVA
cuTVA: 36.28 RON
Camera de supraveghere IP Pan/Tilt
221.49 RON
fara TVA
39.87 RON
pret fara TVA
cuTVA: 47.44 RON
Camera de supraveghere IP
344.54 RON
fara TVA
69.99 RON
pret fara TVA
cuTVA: 83.29 RON
Camera de supraveghere IP Wireless
496.63 RON
fara TVA
104.54 RON
pret fara TVA
cuTVA: 124.40 RON
Client wireless USB 150mbps TP-Link TL-WN722N
46.35 RON
fara TVA
23.69 RON
pret fara TVA
cuTVA: 28.19 RON
Placa de captura DVR Komida BK-V8008A
469.68 RON
fara TVA
113.30 RON
pret fara TVA
cuTVA: 134.83 RON
Placa de captura DVR Komida BK-9108A
297.67 RON
fara TVA
118.24 RON
pret fara TVA
cuTVA: 140.71 RON
Placa de captura DVR Komida BK-9108
455.26 RON
fara TVA
91.26 RON
pret fara TVA
cuTVA: 108.60 RON
Placa de captura DVR Komida BK-9104A
359.47 RON
fara TVA
73.13 RON
pret fara TVA
cuTVA: 87.02 RON
Placa de captura DVR Komida BK-7108
312.09 RON
fara TVA
105.06 RON
pret fara TVA
cuTVA: 125.02 RON
BK-V8004
292.52 RON
fara TVA
80.34 RON
pret fara TVA
cuTVA: 95.60 RON

 
Pagini produse: 12345678
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept