Curs valutar

18-Jun-2019

1 EURO = 4.7228 RON  
1 USD = 4.1899 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5inverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgapatchtrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200

ANPC

Lichidari stocuri

Pagini produse: 12345678
HZS-532E-DE
212.53 RON
fara TVA
174.74 RON
pret fara TVA
HZS-100
141.21 RON
fara TVA
111.93 RON
pret fara TVA
HAC-1000
732.03 RON
fara TVA
609.24 RON
pret fara TVA
Media Convertor Planet FT-802S15
188.91 RON
fara TVA
118.07 RON
pret fara TVA
Archer C2
160.00 RON
fara TVA
115.00 RON
pret fara TVA
QH-D7016C
553.00 RON
fara TVA
250.00 RON
pret fara TVA
QH-D6008CM
257.00 RON
fara TVA
180.00 RON
pret fara TVA
QH-D7108CM
544.00 RON
fara TVA
306.00 RON
pret fara TVA
DVR Standalone H.264 4 canale
570.00 RON
fara TVA
150.00 RON
pret fara TVA
Receptor digital terestru HD Strong SRT-8110
234.70 RON
fara TVA
90.00 RON
pret fara TVA
7700HDCICX
795.00 RON
fara TVA
150.00 RON
pret fara TVA
DF-5442RN
202.00 RON
fara TVA
31.00 RON
pret fara TVA
CK20-CM7030-ICR
74.00 RON
fara TVA
31.80 RON
pret fara TVA
AHD-2173
195.00 RON
fara TVA
29.30 RON
pret fara TVA
PT Dome Controller
60.00 RON
fara TVA
9.90 RON
pret fara TVA
Camera IP DF-S862IP
240.00 RON
fara TVA
38.90 RON
pret fara TVA
Camera de supraveghere IP Pan/Tilt
212.53 RON
fara TVA
38.25 RON
pret fara TVA
Camera de supraveghere IP
330.60 RON
fara TVA
67.16 RON
pret fara TVA
Camera de supraveghere IP Wireless
476.53 RON
fara TVA
100.31 RON
pret fara TVA
Client wireless USB 150mbps TP-Link TL-WN722N
45.00 RON
fara TVA
23.00 RON
pret fara TVA
Placa de captura DVR Komida BK-V8008A
456.00 RON
fara TVA
110.00 RON
pret fara TVA
Placa de captura DVR Komida BK-9108A
289.00 RON
fara TVA
114.80 RON
pret fara TVA
Placa de captura DVR Komida BK-9108
442.00 RON
fara TVA
88.60 RON
pret fara TVA
Placa de captura DVR Komida BK-9104A
349.00 RON
fara TVA
71.00 RON
pret fara TVA
Placa de captura DVR Komida BK-7108
303.00 RON
fara TVA
102.00 RON
pret fara TVA
BK-V8004
284.00 RON
fara TVA
78.00 RON
pret fara TVA
BZ50S-FL
143.00 RON
fara TVA
87.50 RON
pret fara TVA
BZ20S-FL
71.70 RON
fara TVA
44.10 RON
pret fara TVA
BZ10S-FL
52.30 RON
fara TVA
32.30 RON
pret fara TVA
Wireless Splitter Strong RS232WiFi
93.00 RON
fara TVA
60.00 RON
pret fara TVA
Lentila monofocala cu iris fix EPlus EFL1620
31.50 RON
fara TVA
5.20 RON
pret fara TVA

 
Pagini produse: 12345678
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept