Curs valutar


1 EURO = 4.7581 RON  
1 USD = 4.2268 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzac routerenergywirelessraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5inverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgapatchtrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high quality


Lichidari stocuri

Pagini produse: 12345678
Archer C2
160.00 RON
fara TVA
115.00 RON
pret fara TVA
553.00 RON
fara TVA
250.00 RON
pret fara TVA
257.00 RON
fara TVA
180.00 RON
pret fara TVA
544.00 RON
fara TVA
306.00 RON
pret fara TVA
DVR Standalone H.264 4 canale
570.00 RON
fara TVA
150.00 RON
pret fara TVA
Receptor digital terestru HD Strong SRT-8110
234.70 RON
fara TVA
90.00 RON
pret fara TVA
795.00 RON
fara TVA
150.00 RON
pret fara TVA
202.00 RON
fara TVA
31.00 RON
pret fara TVA
74.00 RON
fara TVA
31.80 RON
pret fara TVA
195.00 RON
fara TVA
29.30 RON
pret fara TVA
PT Dome Controller
60.00 RON
fara TVA
9.90 RON
pret fara TVA
Camera IP DF-S862IP
240.00 RON
fara TVA
38.90 RON
pret fara TVA
Camera de supraveghere IP Pan/Tilt
214.11 RON
fara TVA
38.54 RON
pret fara TVA
Camera de supraveghere IP
333.07 RON
fara TVA
67.66 RON
pret fara TVA
Camera de supraveghere IP Wireless
480.09 RON
fara TVA
101.06 RON
pret fara TVA
Client wireless USB 150mbps TP-Link TL-WN722N
45.00 RON
fara TVA
23.00 RON
pret fara TVA
Placa de captura DVR Komida BK-V8008A
456.00 RON
fara TVA
110.00 RON
pret fara TVA
Placa de captura DVR Komida BK-9108A
289.00 RON
fara TVA
114.80 RON
pret fara TVA
Placa de captura DVR Komida BK-9108
442.00 RON
fara TVA
88.60 RON
pret fara TVA
Placa de captura DVR Komida BK-9104A
349.00 RON
fara TVA
71.00 RON
pret fara TVA
Placa de captura DVR Komida BK-7108
303.00 RON
fara TVA
102.00 RON
pret fara TVA
284.00 RON
fara TVA
78.00 RON
pret fara TVA
143.00 RON
fara TVA
87.50 RON
pret fara TVA
71.70 RON
fara TVA
44.10 RON
pret fara TVA
52.30 RON
fara TVA
32.30 RON
pret fara TVA
Wireless Splitter Strong RS232WiFi
93.00 RON
fara TVA
60.00 RON
pret fara TVA
Lentila monofocala cu iris fix EPlus EFL1620
31.50 RON
fara TVA
5.20 RON
pret fara TVA
31.50 RON
fara TVA
5.20 RON
pret fara TVA
31.50 RON
fara TVA
5.20 RON
pret fara TVA
31.50 RON
fara TVA
5.20 RON
pret fara TVA
EPlus EFL02820 lentila monofocala cu iris fix
31.50 RON
fara TVA
5.20 RON
pret fara TVA

Pagini produse: 12345678
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept