Curs valutar


1 EURO = 4.7607 RON  
1 USD = 4.2327 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzac routerenergywirelessraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5inverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgapatchtrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high quality


 » Receptoare de satelit digitale High Definition

Vu+ DUO 2

Vu+ Receptor de satelit digital HD tuner dual

VU PLUS - Vu+ DUO 2 - 1 Dual DVB-S2

Vu + Duo2 with Dual tuner, Dual Display, Dual Performance, Double your expectation

Alte imagini:
Vu+ DUO 2Vu+ DUO 2Vu+ DUO 2Vu+ DUO 2
Vu+ DUO 2
Acest produs nu mai este disponibil!


Vu+ DVB-S2 tuner

Vu+ DVB-C/T/T2 tuner

Vu+ DVB-S2 Twin tuner


  • Powerful Dual Core CPU
    No more interrupted moment when using DUO2
    With the Powerful Dual Core CPU 1.3 GHz (MIPS based), the speed of operating functions is faster than you ever imagined. You will be satisfied with the system loading speed of functions such as booting, using plug-ins, or channel tuning.
  • Dual Display 
    Double viewing screens provide double
    amount of convenience
    The front panel of Duo2 is equipped with both LCD and VFD. (TFT LCD 3.2" / 262,000 Color / 16bit) VFD provides basic information such as channels and time, while LCD screen provides more interesting information or use the LCD screen as a digital picture frame by putting your personal photo slides and so on. Dual display can increase both text and graphic content of multiple presentations. through LCD4Linux Plug-in. For example, you can have frequently updated weather, With the dual display option, viewing experience comfort level will be intensified.
  • 1080p FULL HD Make your TV screen more realistic than ever before with DUO2The strong performance is ideal for 1080p Full High Definition decode and display. You will enjoy every second of watching TV due to the sharp and vivid images on your TV screen.
  • Built-in Wi-FI Easy and Simple Internet Connection with Built-in Wi-FiDuo 2 features built-in Wi-Fi that connects to the Internet without any additional devices or wires. With the built-in Wi-Fi, you can fully enjoy high-definition streaming or web browsing. Built-in Wi-Fi allows enhanced multimedia applications with the easy access to the Internet.
  • Transcoding Enjoy TV contents on your personal mobile devices.Duo2 is the only box with the transcoding feature, which enables watching TV or other contents in different rooms via streaming. It provides the new level of convenience by providing transcoding system.Make your watching TV moment extra interactive with your personal electronic devices such as iPad or smart phones by down converting.
  • Recording up to 16 channels DUO2 makes it impossible to miss any of your favorite channel.You can record up to 16 Live channels simultaneously. There may be moments when you had to miss one for the other channels due to the lack of recording ability of previous STB.However, with DUO2, it is literally impossible for you to leave out any LIVE channels. With HDD (3.5 inch) internally equipped, you can play the recorded files whenever you want from Archive.
  • HbbTV Enjoy interactive services on your own living room.Duo 2 is the "HbbTV" supported set-top box. "HbbTV", Hybrid Broadcast Broadband TV, is a major new pan-European initiative aimed at harmonizing the broadcast and broadband delivery of entertainment to the end consumer through connected TVs and Set-Top Boxes. In other words, HbbTV enables you to experience web browsing while watching the Live channel interactively at the same time.Main applications include TV Guide, Catch-up service, web video, VOD, or portal service. Additionally, you can check the weather, sports, news and etc,.
  • HD Picture in Picture More satisfactory experience of watching main & supplementary screens in HD quality.PiP(Picture in Picture) is displayed in High-Definition. There are no such thing as less important screen in DUO2 as it makes every viewing moment in HD quality.
  • Plug-Ins Double up your entertainment choices with various Plug-Ins.Various plug-ins developed by independent developers makes the whole experience of using DUO2 simple and incredibly fun. You can enjoy all those plug-ins with just simple click of downloading. There are Plug-ins made just for DUO2.You can view any contents from your TV screen to your mobile devices anywhere you want as long as you are in the same network. Not only do Plug-ins provide entertainment, but they also enable you to customize your own DUO2. It can have daily weather check frequently updated or even slide show of your favorite pictures.

Basic specification

Processor Broadcom 7424
Processor type 1.3 GHz (3K + DMIPS)
Display Color TFT LCD graphic VFD Display 256×64 Pixels
Memory Controller Dual 32-bit DDR3
Memory 1 GB
SATA/eSATA 1x / 1x
Internal Hard Drive 2,5 – 3,5″
Linux Kernel 3.x Yes
Tuner fix/plug - / 2x
PiP/Bild in Bild SD/SD H/W PIP
PiP/Bild in Bild HD/HD H/W PIP
Playback of HD (720p) Xvid/AVI – contents Yes
Loop tuner Yes
Number of optional USB tuners 2
Cooler / Fan active / -
Remote Control Universal (Sat/TV)
Common Interface 2
Smartcard Reader 2
USB 2.0 2+1
Image/Firmware via USB Yes
Flashing query Yes
Lan/WLan 100Mbit / Optional via USB
HDMI CEC Control Yes
Dolby Digitla Plus Yes
3D Mode (Side by Side / Top & Bottom) Yes
3D Themes Yes
Blindscan Yes



















Vu+ comparison table


Vu+ Duo2 Solo Solo2 SoloSE SoloSE V2 Zero Solo 4K
CPU (MHz) 2×1300 333* 2×1300 2×1300 2×1300 742 2×1500
RAM (MB) 2048 256 1024 1024 1024 512 2048
Flash (MB) 1024 128 256 256 512 256 4096
Flash type (NAND) (NAND) (NAND) (NAND) (NAND) (NAND) eMMC
DVB 2 x S2/C/T2
1 x S2 2 x S2 1 x S2/C/T/T2
1 x Dual S2/C/T/T2
1 x (S2) 1 x Fixed Dual FBC
1 x Dual S2/C/T/T2
HDTV Yes Yes Yes Yes Yes Yes Yes
3D TV Yes Yes Yes Yes Yes Yes Yes
PiP Yes No Yes/HD Yes Yes No Yes
Common Interface 2 2 1 1 1 No 1
Smart card 2 1 2 1 1 1 2
USB 3 x 2.0 2 x 2.0 3 x 2.0 2 x 2.0 2 x 2.0 2 X 2.0 2 x 3.0 & 1 x 2.0
RS232 Yes Yes Yes Yes Yes Yes Yes
LAN (Mbit/s) Gigabit + WiFi 802.11n(up to 300Mbps) 100 Gigabit 100 100 100 Gigabit + WiFi 802.11n(up to 300Mbps)
HDD 2.5/3.5 in No 2.5 in No No No Detachable 2.5″
eSATA Yes No No Yes Yes No No
SCART 1 1 1 No No No No
HDMI 1 1 1 1 1 1 1 x (2.0)
Display 3.2″ TFT LCD (65 536 / 16bit) No VFD Status LED Status LED Status LED 3.5″ TFT LCD (262 000 / 18bit)
Other connectors Digital Audio:S/PDIF, Analogue Audio:Right & Left (Cinch x 2), Analogue Video: Component Video (YPbPr), Composite Video (Cinch x 1 ) 1 x YPrPb   Digital Audio : S/PDIF, Analogue Audio : Right & Left(Cinch x 2) Composite Video (Cinch x 1 ) Digital Audio : S/PDIF, Analogue Audio : Right & Left(Cinch x 2) Composite Video (Cinch x 1 ) Composite Video & Analog Audio (Stereo Jack X 1) Digital Audio: S/PDIF



Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept