Curs valutar

24-Aug-2019

1 EURO = 4.7216 RON  
1 USD = 4.2706 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvc

ANPC

 » Echipamente de crimpat si sertizat, cleste profesional de sertizare, tester retea



NF-889

Tester Retea multifunctional NF-889

Braun Group - NF-889

Detector de cabluri neconectate la tensiune, sub pamant sau in pereti. Wiremap pentru cabluri de date pe conector RJ45.
Echipamentul este format din transmitator de ton cu frecventa de 1000Hz si receptor. Transmitatorul se leaga la capatul cablului ce trebuie detectat ( electric, de date, telefonic, conducte metalice). Receptorul (scaner) este prevazut cu o antena de detectie, indicator LED si mufa jack pentru casti externe (incluse). Atat emitatorul cat si receptorul se alimenteaza de la baterii de 9VDC (neincluse). Temperaturi de operare -10+50 grade Celsius
Alte imagini:
NF-889NF-889
Pret fara TVA:
136.93 RON

Pret cu TVA :
162,94 RON

Disponibilitate :
Sunati

NF-889 - Multifunctional Network Cable Tester
Port : RJ45, Cable clip with RJ11 connector
Tracing Type : UTP/STP RJ45, RJ11 and Metal Cable
Testing Type: Shielded and unshielded RJ45 (8P8C)
Power : 9V Alkaline battery

Features:

  1. Check and find the needed cables among so many cables in one time.
  2. Continuity test — wiremap for Lan cables.
  3. Diagnose the breakage, open, short, cross.
  4. Visible indication: pin-to-pin cable map for individual cable (not by pairs).
  5. Transmitter with RJ11 connector and pair of alligator clips.
  6. Low Voltage alarm function.
  7. Earphone permits use in noisy environments.
  8. LED light assists use in dark corners.
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept