Curs valutar


1 EURO = 4.8393 RON  
1 USD = 4.2695 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpgigabitz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerplugprizaraspberry piaudiovideocable4 contactrcajackamikoac routerunifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin


Planet POE 2018 Catalogue

Switch-uri si injectoare PoE

  Descriere Pret
pe6108hPOE switch 8port cu 4 *POE 17W & 4Port Uplink, sursa PoE 69W- 48V/1,45W interna Netis - PE6108H

8 Port Fast Ethernet 10/100 PoE Switch/4 Port PoE /802.3af; (Half POE )
Metal housing, desktop, internal power supply 69W,
PoE Power
Supports PoE power up to 17W for each PoE port, 69W for all PoE ports internal power supply
8 *10/100Mbps RJ45 port, including 4 PoE ports (Port 1-Port 4)

Pret vechi 212.18 RON
Pret nou
143.17 RON
*) Pretul nu contine TVA
cuTVA: 170.37 RON
Disponibilitate : In stoc
24-Port Gigabit L2 Lite Managed Switch with 4 Combo SFP SlotsTP-Link TL-SG3424PJetStream 24-Port Gigabit L2 Managed PoE+ Switch + 4 SFP Slots (384W) TP-Link - T2600G-28MPS(TL-SG3424P)

Switch L2 24port PoE+ Gigabit si 4 slot-uri SFP.  Supports 24 802.3at/af-compliant POE+ ports with a total power supply of 384W. L2+ feature: Static Routing, helps route internal traffic for more efficient use of network resources

Pret : 1,526.00 RON
*) Pretul nu contine TVA
cuTVA: 1,815.94 RON
Disponibilitate : In stoc
GS-4210-8P2S - front8-Port 10/100/1000T PoE + 2-Port 100/1000X SFP Management Planet - GS-4210-8P2S

8-Port 10/100/1000T 802.3at PoE + 2-Port 100/1000X SFP Managed Switch

Pret : 875.91 RON
*) Pretul nu contine TVA
cuTVA: 1,042.34 RON
Disponibilitate : Sunati
Switch desktop PoE 8-porturi 10/100M TP-Link TL-SG1008PSwitch desktop PoE 8-porturi 10/100M TP-Link - TL-SF1008P

Switch desktop 8-porturi 10/100M, 4 porturi POE, carcasa metalica

Pret : 175.00 RON
*) Pretul nu contine TVA
cuTVA: 208.25 RON
Disponibilitate : Sunati
GSD-804P, switch Gigabit cu POESwitch POE gigabit 8 porturi gigabit Planet - GSD-804P

Switch gigabit 8 porturi cu 4 porturi POE

Pret : 309.72 RON
*) Pretul nu contine TVA
cuTVA: 368.56 RON
Disponibilitate : Sunati
6108ghFull Gigabit 8Port Switch /4 *PoE+ 30W, 802.3at & 4 *gigabit uplink Netis - PE6108GH

8 Port Gigabit Ethernet PoE Switch half POE/
echipat cu 4 Port PoE/802.3at/af

Pret vechi 360.71 RON
Pret nou
307.66 RON
*) Pretul nu contine TVA
cuTVA: 366.12 RON
Disponibilitate : In stoc
Power over Ethernet Adapter Kit TL-POE200Kit Power over Ethernet 48V = Injector +splitter TP-Link - TL-PoE200

Kit Power over Ethernet Adapter Kit, 1 Injector  ( Power Supply Unit of PoE Injector 48V) & 1 Spliter ( output 12V/9V/5V)  incluse,
Permite extensie PoE 100m over AWG24/ 23 copper cables ,iesire 12/9/5VDC, Plug and Play.

Pret vechi 90.00 RON
Pret nou
79.57 RON
*) Pretul nu contine TVA
cuTVA: 94.68 RON
Disponibilitate : Sunati
Switch 5*10/100 , 4 PoE * 15.5W/port, PSU-POE= 65WIPCOM PoE switch 250m surveillance 5*10/100 , 4 PoE * 15.5W/port, sursa PoE 51V/1.25A, protectie 4kV/6kV,garant 3ani, (TEF1105P) IP-COM - F1105P-4-63W

 FP1105P-4-63W este o solutie PoE profesionala pentru sisteme de supraveghere pe distanta de pina la 250 metri oferit intr-o carcasa metalica compacta, cu protectie la fulgere 4kV/6kV si garantie 3ani
Switch PoE cu 5 porturi, 4x PoE (autodetect ) &1x uplink 10/100.
In pachet cu sursa externa 51V/ 1.25A  (63W full protected),
Acesta poate detecta automat si furniza energie pentru toate dispozitivele portabile(PD)IEEE 802.3af/compliant. Activarea modulului Ethernet Extend face porturile 1-4 sa imparta la rata de duplex totala de 10M si sa se izoleze unu de altul,dar toate comunicand cu portul Uplink.
Comutator manual pe panoul frontal pentru extinderea la 250metri in modul surveillance. Distanta maxima este oferita pe cabluri UTP de cupru de calitate AWG24/AWG23

Pret vechi 130.92 RON
Pret nou
107.81 RON
*) Pretul nu contine TVA
cuTVA: 128.30 RON
Disponibilitate : Sunati
TL-POE150SPoE injector gigabit 48V/15.5W TP-Link - TL-POE150S

POE injector gigabit: 1 port PoE, se conformeaza IEEE 802.3af, permite transfer de date si de energie pe acelasi cablu pana la 100m, carcasa plastic, format de buzunar, plug and play, RoHS.

Pret : 82.70 RON
*) Pretul nu contine TVA
cuTVA: 98.41 RON
Disponibilitate : In stoc
16-Port 10/100/1000Mbps 802.3at PoE+ Ethernet SwitchSwitch POE 16port 10/100/1000Mbps , 802.3at Planet - GSW-1600HP

16-Port 10/100/1000Mbps 802.3at PoE+ Ethernet Switch

Pret vechi 866.23 RON
Pret nou
811.17 RON
*) Pretul nu contine TVA
cuTVA: 965.30 RON
Disponibilitate : Sunati
F1110P-8-102WSwitch gigabit 10p cu 8*10/100 PoE+ 2 x 10/100/1000 Gigabit uplink, CCTV 250m, 6kV protectie, 3ani, include sursa 51V2A IP-COM - F1110P-8-102W

F1110P-8-102W este switch POE cu 8 porturi POE 10/100M + 2 port Uplink 10/100/1000M pentru surveillance, cu protectie la fulgere 6kV special proiectat pentru alimentarea PoE a camerelor IP sau routere/ AP instalate in exterior, cu extindere pana la 250mt in mod surveillance. Prezinta trei moduri de lucru: Default / VLAN /Extend (CCTV)
Este livrat la pachet impreuna cu sursa externa PoE de 102 Watt ( 51 volt, 2A)  ( poate fi upgradat si cu surse de 120W sau 150W)
Acesta ofera 10/100 Base-TX porturi RJ45 si 2 porturi 10/100/1000 Base-T RJ45 porturi. Porturi 1-8 suport IEEE 802.3la PoE cu fiecare port furnizeaza putere de 15,4 W, sau IEEE 802.3af PoE+ (30W) Întregul dispozitiv poate furniza alimentare de pâna la 96W. 

Pret vechi 354.25 RON
Pret nou
302.91 RON
*) Pretul nu contine TVA
cuTVA: 360.46 RON
Disponibilitate : In stoc
PE6108GGigabit POE *8 PoE Switch 802.3at 155Watt; metal /rack 19'' Netis - PE6108G

8 Port Gigabit Ethernet PoE Switch 802.3at/af, 8 Port PoE giga- maxim 30W/port,
montabil in rack 19";
19 inch steel housing/ NETIS Switch POE 19'' 8-port 1 GB (8 ports POE 30W/Port max 120W) PE6108G

Pret vechi 509.23 RON
Pret nou
402.08 RON
*) Pretul nu contine TVA
cuTVA: 478.48 RON
Disponibilitate : In stoc
TL-POE10RPoE Splitter -iesire 12V; 9V; 5V TP-Link - TL-POE10R

IEEE 802.3af compliant, Selectable power output, Gigabit speed support, Plug-and-Play, requires no configuration

Pret : 48.00 RON
*) Pretul nu contine TVA
cuTVA: 57.12 RON
Disponibilitate : In stoc
GSD-604HP_fataSwitch POE 4 porturi Gigabit + 2 porturi Uplink Gigabit (55Wati) Planet - GSD-604HP

4-Port 10/100/1000T 802.3at PoE + 2-Port 10/100/1000T Desktop Switch (External 55 Watts)

Pret : 271.00 RON
*) Pretul nu contine TVA
cuTVA: 322.49 RON
Disponibilitate : In stoc
PSE3101ACPoE injector 30W, 52V, IEEE 802.3at Braun Group - PSE31-O1AC (PSE3101AC)

Injector PoE compact cu un port 10/100M POE ( mid-span), standard IEEE 802.3at, putere port POE 30W,  Putere maxima 35W.

Pret vechi 74.26 RON
Pret nou
58.35 RON
*) Pretul nu contine TVA
cuTVA: 69.44 RON
Disponibilitate : Indisponibil
4 Ports Poe Switch4 Ports Poe Switch UTEPO - UTP3-SW04-TP60

UTP3-SW04-TP60 is a security surveillance Ethernet Switch which aims at Ethernet high definition surveillance and security system. The product fully combines the characteristics of security surveillance, provides fast packet forwarding ability and abundant backplane bandwidth, which ensures clear image and fluent transmission. ESD and surge protection circuit can improve product stability. The product supports one key CCTV model, with VLAN function can restrain the network storm, protect the information security, prevent the viral transmission and cyber attack, fully satisfy the Ethernet video security surveillance system and Ethernet project needs. 

Pret : 193.55 RON
*) Pretul nu contine TVA
cuTVA: 230.33 RON
Disponibilitate : Sunati
Switch PoE 802.3at Desktop 8 porturi 10/100mbpsSwitch PoE 802.3at Desktop 8 porturi 10/100mbps Planet - FSD-808HP

Switch PoE 802.3at Desktop 8 porturi 10/100mbps

Pret vechi 387.14 RON
Pret nou
338.75 RON
*) Pretul nu contine TVA
cuTVA: 403.11 RON
Disponibilitate : Sunati
8-Port 10/100/1000T Wall Mounted Gigabit POESwitch wallmount 8 porturi gigabit/4 porturi POE Planet - WGS-804HP

8-Port 10/100/1000T Wall Mounted Gigabit Ethernet Switch with 4-Port PoE+

Pret : 604.91 RON
*) Pretul nu contine TVA
cuTVA: 719.85 RON
Disponibilitate : Sunati
S3300-18-PWR-MIPCOM 18 port WEB smart PoE Switch cu 16*POE+ & 2 port * Gigabit TP/SFP combo, protectie fulgere, 250 m surveillance mode IP-COM - S3300-18-PWR-M

S3300-18-PWR-M este un Switch Web smart POE cu 18 porturi 

include 16 porturi active PoE 10/100Mbps ( pina la 250 metri )+2 Port uplink Gigabit TP/SFP combo . Acesta are 16 porturi RJ45 10/100 Base-TX,2 porturi RJ45 10/100/1000 Base-T si 2 combinatii 1000Base-X SFP.Are o putere totata de 230W.Prin utilizarea Cat.5 dispozitivul poate furniza date si putere pentru AP-uri,camere IP.Distanta de transmisie poate ajunge pana la 250 de metri.
Functiile WEB smart includ QVLAN, link aggregation, QoS, MAC binding


Pret vechi 924.12 RON
Pret nou
764.97 RON
*) Pretul nu contine TVA
cuTVA: 910.31 RON
Disponibilitate : Sunati
FGSW-1822VHP fata16-Port 10/100TX PoE + 2-Port Gigabit TP/SFP Combo, LCD Planet - FGSW-1822VHP

16-Port 10/100TX 802.3at PoE + 2-Port Gigabit TP/SFP Combo Ethernet Switch with LCD PoE Monitor (300W)

Pret : 1,088.84 RON
*) Pretul nu contine TVA
cuTVA: 1,295.72 RON
Disponibilitate : Sunati
BSP-300BSP-300 Planet - BSP-300

Industrial Solar Power PoE Switch

Pret : 1,956.06 RON
*) Pretul nu contine TVA
cuTVA: 2,327.71 RON
Disponibilitate : Sunati
front8-Port 10/100TX PoE + 2-Port Gigabit TP/SFP Combo, LCD Planet - FGSD-1022VHP

8-Port 10/100TX 802.3at PoE + 2-Port Gigabit TP/SFP combo Desktop Switch with LCD PoE Monitor (120 Watts)

Pret : 619.43 RON
*) Pretul nu contine TVA
cuTVA: 737.12 RON
Disponibilitate : Sunati
PE-61088 Ports Fast Ethernet Switch Integrate 8 POE Ports 135W internal power Netis - PE6108

8  Ports Fast Ethernet Switch Integrate 8 POE Ports, autodetectie
FULL POWER, 135W, rack mount 13inch metal

Pret : 318.27 RON
*) Pretul nu contine TVA
cuTVA: 378.74 RON
Disponibilitate : Sunati
PoE InjectorIPCOM PoE15F Injector 48V/ 0.4A, 10/100Mbps, 19W, & cablu IEC13, retail, IEEE802.3u, 3ani garantie IP-COM - PSE15F
Oferta promo: 29.50 lei per buc pentru comanda 20 buc injector/ garantie 3 ani.
27.50 lei per buc pentru comanda 100 buc injector/ garantie 3 ani.
Injector Activ PoE 10/100Mbps pentru camere IP, AP,... compatibile PoE standard. IEEE802.3, IEEE802.3u
include sursa 19.20W & cablu 220Volt tip IEC13-PC 3*0.75mm2 laptop (laptop conector) 
Injectorul PoE PSE15F poate realiza transmiterea sincrona a datelor de retea si putere prin intermediul unui cablu Ethernet (Cat.5). Puterea de iesire  19.20 W care poate servi ca iesire pentru un dispozitiv PoE (alimentare RJ45). Poate fi conectat la un dispozitiv compatibil IEEE 802.302af,cum ar fi: AP, camera IP, switch IP, IP-phone, etc
Este o alegere buna pentru reducerea costurilor de instalare si imbunatatirea performantei retelei.
Pret vechi 46.21 RON
Pret nou
37.99 RON
*) Pretul nu contine TVA
cuTVA: 45.21 RON
Disponibilitate : In stoc
front4-Port 10/100Mbps 802.3af/at PoE + 1-Port 10/100Mbps Planet - FSD-504HP

4-Port 10/100Mbps 802.3af/at PoE + 1-Port 10/100Mbps Desktop Switch (60 Watts)

Pret nou
164.29 RON
*) Pretul nu contine TVA
cuTVA: 195.50 RON
Disponibilitate : Sunati
front24-Port 10/100TX PoE + 2-Port Gigabit TP/SFP Combo with LCD Planet - FGSW-2622VHP

24-Port 10/100TX 802.3at PoE + 2-Port Gigabit TP/SFP Combo Ethernet Switch with LCD PoE Monitor (300W)

Pret : 1,330.81 RON
*) Pretul nu contine TVA
cuTVA: 1,583.66 RON
Disponibilitate : Sunati
PE6310GF8POE giga+2 SFP Full Gigabit Ethernet SNMP 8PoE+ Switch Netis - PE6310GF layer2 POE+
Smart switch gigabit cu 8 porturi Giga full POE 30watt +2 SFP uplink , sursa POE interna 250Watt
- Gigabit Ethernet SNMP PoE Switch PE6310GFH provides a great selection for expanding your home or office network. It fully complies with IEEE802.3/802.3u/802.3ab/802.3z Ethernet standards.
19inch rack mountable kit
Pret vechi 867.65 RON
Pret nou
585.28 RON
*) Pretul nu contine TVA
cuTVA: 696.48 RON
Disponibilitate : Indisponibil
PE6310HSwitch smart PoE 10 Port gigabit uplink, 4*POE 10/100 +4 *10/100+ 2 combo gigabit SFP/ GE 10/100/1000 Netis - PE6310H

8FE+2 Combo-Port Gigabit Ethernet SNMP PoE Switch

4 POE ports din 8 port *10/100 + 2 port uplink combo gigabit 10/100/1000 & SFP minigbic
2 Combo-Port Gigabit Ethernet SNMP PoE Switch ( sursa 75 watt intern)
porturile 1 la 4 pot furniza o putere maxima de 30W/ port, puterea totala pe cele 4 porturi fiind de 75Watt

The 8FE+2 Combo-Port Gigabit Ethernet SNMP PoE Switch PE6310H provides a great selection for expanding your home or office network. it is fully complies with IEEE802.3/802.3u/802.3z Ethernet standards. It provides 8*10/100Mbps RJ45 Ports and 2 Combo 10/100/1000Mbps SFP Slots. Port 1 to port 4 support Power over Ethernet(PoE) function.It can automatically detect and supply power with the IEEE 802.3at/af compliant Powered Devices (PDs), like PoE APs, IP Phones,IP cameras, etc. It also provides powerful management functions, including 802.1p (QoS), DiffServ(QoS), IGMP Snooping, 802.1w (Rapid Spanning Tree), Link Aggregation, 802.1q (VLANs), 802.1x and more. It's a perfect way to extend your network structure.

Pret vechi 462.06 RON
Pret nou
346.55 RON
*) Pretul nu contine TVA
cuTVA: 412.39 RON
Disponibilitate : Sunati
Gigabit PoE InjectorIPCOM-Gigabit PoE Injector 30W, 802.3AT IP-COM - PSE30G-AT

vezi si produsul echivalent POE30G-AT
Gigabit PoE Injector 30W / 48V, IEEE 802.3AT compliant, pentru aplicatii profesionale
functie auto-detect pentru ( puterea solicitata de device-ul PoE); include sursa externa de 30watt  & cablu 220Volt tip laptop (laptop conector)
PSE30G-AT poate porni automat,avand functie la scurtcircuit pentru a intrerupe alimentarea electrica atunci cand primeste un curent prea mare,sau in cazul intreruperii electricitatii,pentru a prevenii epuizarea echipamentului si a defectarii retelei cauzate de intreruperea alimentarii cu energie.Aceasta functiei face ca PSE30G-AT sa poate fi aplicat pe o scara larga la dispozitive de retea fara fir,bluetooth,IP-telefon,compatibil cu IEE 802.3af/at.Se potriveste cu separatorul Ethernet Power pentru a schimba reteaua curenta in sursa LAN,pentru o gestionare usoara,pentru a consolida controlul si a pentru a reduce costul de intretinere.

Pret : 78.55 RON
*) Pretul nu contine TVA
cuTVA: 93.48 RON
Disponibilitate : Indisponibil
POE-163Adaptor power over ethernet gigabit Planet - POE-163EU

Adaptor POE, 10/100/1000, se conformeaza standardului IEEE 802.3at/af, maxim 30W/port, permite transfer de date si de energie pe acelasi cablu pana la 100m,

Pret : 140.34 RON
*) Pretul nu contine TVA
cuTVA: 167.00 RON
Disponibilitate : Sunati
S3300-10-PWR-MIPCOM-10port WEB Smart PoE Switch 8-Port POE+ 2 combo Gigabit TP/SFP IP-COM - S3300-10-PWR-M

S3300-10-PWR-M este un Switch PoE Smart cu 8 porturi ,10/100 Mbps + 2 porturi uplink Gigabit cupru /gigabit SFP (combo).
Acesta oferŃ 8 porturi RJ45 10/100Base-TX, 2 porturi RJ45 10/100/1000 Base-T și 2 combinații 1000Base-X SFP.Puterea totala a iesirii este de 123W.Prin utilizarea Cat.5 dispozitivul poate furniza date si putere AP-uri,camere IP.Prin utilizare Cat.5e Ethernet distanta de transmisie a datelor si a puterii poate fi de pana la 250 de metri.

Pret : 467.20 RON
*) Pretul nu contine TVA
cuTVA: 555.96 RON
Disponibilitate : Sunati
poe-164Adaptor power over ethernet Planet - POE-164

Adaptor POE, se conformeaza standardului IEEE 802.3at/af, maxim 30W/port, permite transfer de date si de energie pe acelasi cablu pana la 100m,

Pret : 120.98 RON
*) Pretul nu contine TVA
cuTVA: 143.97 RON
Disponibilitate : Sunati
TEF1109PSwitch PoE+ 9 port 10/100 Mbps cu 8 PoE+ &uplink, surveillance 150m, protectie 6kV, sursaPoE 127watt 51V/2.5A Tenda - TEF1109P-127W

Acest switch PoE Tenda fabricat in serie limitata pentru camere de mare putere are in pachet inclusa o sursa externa PoE 51V de mare putere 127Watt, protectii avansate la fulgere 6kV, mode CCTV selectabil din buton, si o garantie 2 ani. Este ambalat in cutie retail- dimensiuni mici de gabarit ( on the field).
TEF1109P, 9-Port 100M Unmanaged Tenda Switch with 8 PoE ports, is specialized on wireless and monitoring networks. It adopts professional PoE swtich solution, provides 9 10/100M auto-negotiated RJ45 ports;  
Comutator manual in mod surveillance, extinde raza de actiune la peste 150metri de cablu.
Ports 1~8 support IEEE802.3af/IEEE802.3at PoE power supply, and can automatically detect and identify the IEEE802.3af/IEEE802.3at-based powered devices, and can suppply PoE power for them via Ethernet cables. The uplink port is equipped with professional lightning protection circuit, which is 4KV lightning-proof. One-key VLAN devision feature can help restraint broadcast storm and defense DHCP spoofing. UPNP and zero configuration save you a lots using troubles; moreover, PoE supply makes power cabling more easily and flexibly.

Pret vechi 228.09 RON
Pret nou
196.27 RON
*) Pretul nu contine TVA
cuTVA: 233.56 RON
Disponibilitate : Sunati
G3210PIPCOM 8-Port Gigabit+2*SFP Managed PoE Switch, protectie fulgere IP-COM - G3210P
G3210P, IP-COM 8G+2SFP Managed PoE Switch is right for remote Gigabit wireless cabling and HD monitoring network. Besides with access of high performance, it provides 8 10/100/1000 Base-T Ethernet ports and 2 extra independent 1000Base-X Gigabit SFP ports. Ports 1~8 support IEEE 802.3af PoE (15.4W) or 802.3at PoE+ (30W) standard; up to 40W power output per PoE port; and can supply electricity to high-power PDs such as dual band/11AC devices; supply electricity and transmit data at the same time to AP, IP Camera or IP Phone via Cat.5e twisted-pair cables.
Pret vechi 613.52 RON
Pret nou
446.66 RON
*) Pretul nu contine TVA
cuTVA: 531.52 RON
Disponibilitate : Sunati
GS-4210-24PL4CSwitch POE Gigabit 24 port + 4 port Combo TP/SFP (440W) Planet - GS-4210-24PL4C

24-Port 10/100/1000T 802.3at PoE + 4-Port Gigabit TP/SFP Combo Managed Switch

Pret : 2,008.31 RON
*) Pretul nu contine TVA
cuTVA: 2,389.89 RON
Disponibilitate : Sunati
POE15FInjector PoE IEEE 802.3af, 10/100Mbps 48V/400mA, 19W, 2*RJ45 Tenda - POE15F

 PoE injector 10/100 tensiune 48V/15.5W, sursa PoE full protection, plug & play;
1*FE data in / 1FE ( data +power) out

The PoE injector PoE15F can realize synchronous delivery of device network data and power via one Ethernet cable (Cat.5 or better). The output power of per port is up to 15,5 W, which can serve as an outlet for a PoE device (powering via RJ45 port). You can connect PoE15F to an IEEE 802.3af compliant PD, such as wireless AP, IP camera, IP phone, etc. In a sense, it is a good choice for you to reduce the installation cost and improve the network performance.

Pret vechi 46.21 RON
Pret nou
37.99 RON
*) Pretul nu contine TVA
cuTVA: 45.21 RON
Disponibilitate : Sunati
POE TESTERTester PoE IEEE 802.3af/at Planet - POE TESTER

Quickly tests RJ-45 outlet for Power over Ethernet existence, Two LEDs indicate the types of PSE (power source equipment),End-span PoE switch- Mid-span PoE injector / injector hub- 4-pair, 60-watt ultra PoE injector,Compliant with IEEE 802.3at/af PoE standard, Plug and Play design


Pret : 54.93 RON
*) Pretul nu contine TVA
cuTVA: 65.37 RON
Disponibilitate : Sunati
FNSW-1600P16-Port 10/100Mbps PoE Fast Ethernet Switch Planet - FNSW-1600P

16-Port 10/100Mbps PoE Fast Ethernet Switch

Pret vechi 580.72 RON
Pret nou
564.74 RON
*) Pretul nu contine TVA
cuTVA: 672.04 RON
Disponibilitate : Sunati
POE-E3041-Port Ultra PoE to 4-Port 802.3af/at Gigabit PoE Extender Planet - POE-E304

PLANET POE-E304 is a 1-port 60W Ultra PoE to 4-port 802.3af/at Gigabit PoE Extender designed especially for point to multipoint PoE applications. The POE-E304 can obtain a maximum of 60-watt PoE power from Ultra PoE input port and supplies a maximum of 55-watt PoE power budget for four PoE output ports, extending both the Gigabit Ethernet Data and IEEE 802.3at/802.3af Power over Ethernet over the standard 100m (328 ft.) Cat. 5/5e/6 UTP cable to up to two 200m powered devices at the same time.

Pret : 266.16 RON
*) Pretul nu contine TVA
cuTVA: 316.73 RON
Disponibilitate : Sunati
9 Ports Gigabit POE SwitchSwitch Gigabit PoE 10Port cu 8PoE gigabit & Uplink Giga-Cu & SFP & 96w POE sursa Braun Group - GP811+96W sursa

Switch full Gigabit POE ( 802.3 af/AT) cu 10 porturi gigabit si 8 porturi PoE & doua porturi de uplink , cupru gigabit & SFP 1.25G gigabit 1000x slot. Furnizeaza PoE pe 8 port* gigabit 10/100/1000 (max 96W). Constructie compacta cu flansa pentru instalare in closere / spatii inguste. Protectie la fulgere.
sursa 48V, 2A , alimentare 100V-240V
with 9 auto-negotiation, auto MDI/MDIX RJ45 ports,1-8 ports support IEEE 802.3af/at PoE standard, plug and play; With the innovative energy-efficient technology, users can choose the PoE switch according power consumption, making it an eco-friendly solution for home/business networking.

Pret vechi 410.72 RON
Pret nou
374.78 RON
*) Pretul nu contine TVA
cuTVA: 445.99 RON
Disponibilitate : Sunati
IPX4P2RIndustrial POE 10/100 switch 6 port cu 4* PoE +2*RJ45 Uplink IP40, DinRail Mount Braun Group - IPX4P2R

Switch PoE industrial IEEE 802.3 at ,  grad de protectie  IP40, (  temperatura de lucru -40C ... +80C grade),
 4*port PoE 10/100 + 2 port Uplink , 802.3 af/at, puterea furnizata  max 30W/ port ,
tensiunea PoE de alimentare:  DC 48-57V  (sursa PoE nu este inclusa)

Pret vechi 316.15 RON
Pret nou
275.83 RON
*) Pretul nu contine TVA
cuTVA: 328.24 RON
Disponibilitate : Sunati
9 Ports Gigabit POE Switch10 Ports Gigabit POE Switch ( 8*POE giga+giga uplink+1.25G SFP fiber port, 120W Braun Group - GP811H

Switch PoE plus ( 802.3 af/AT) cu 10 porturi gigabit si 8 porturi PoE  & doua porturi de uplink , cupru gigabit & SFP 1.25G gigabit 1000x slot. Furnizeaza PoE pe 8 port* gigabit 10/100/1000 (max 120W). Constructie compacta otel cu flansa pentru instalare in closere / spatii inguste.
are protectie la fulgere 4kV
include in pachet PSU 120Watt ( 48V*2.5A) , in 100-240Vac
with 9 auto-negotiation, auto MDI/MDIX RJ45 ports,1-8 ports support IEEE 802.3af/at POE standard, plug and play; Fiber uplink
With the innovative energy-efficient technology, users can choose the PoE switch according power consumption, making it an eco-friendly solution for home/business networking.

Pret vechi 451.79 RON
Pret nou
415.86 RON
*) Pretul nu contine TVA
cuTVA: 494.87 RON
Disponibilitate : Sunati
PoE30G-ATInjector 30Watt PoE Gigabit IEEE802.3at Tenda - POE30G-AT

Tenda PoE30G-AT is IEEE802.3at Gigabit PoE Injector, fully complies wtih 802.3at standard, it enables to delivery power by Ethernet cable, maximum transfer distance is up to 100 meters. The PoE Injector features over two Ethernet Gigabit data port and a output port combined data and power. Also, the device enables to IEEE802.3af/at-compliant PoE power application for Ethernet device such as wireless AP, VoIP phone and web cam. PoE30G-AT supplies power by Ethernet cable, not only providing system reliability, traditional electric network extension but simplifing electric wires deployment.

Pret : 79.58 RON
*) Pretul nu contine TVA
cuTVA: 94.70 RON
Disponibilitate : Indisponibil
PE6310GFHGigabit PoE smart fiber switch 8G_POE+2 SFP-Port Gigabit Ethernet SNMP PoE Switch Netis - PE6310GFH
  8GE+2 SFP-Port Gigabit Ethernet SNMP PoE Switch PE6310GFH provides a great selection for expanding your home or office network. It fully complies with IEEE802.3/802.3u/802.3ab/802.3z Ethernet standards.
Pret vechi 713.63 RON
Pret nou
536.50 RON
*) Pretul nu contine TVA
cuTVA: 638.44 RON
Disponibilitate : Sunati
IPG2P2SIndustrial Gigabit switch 2PoE+ 2SFP = MC bridge POE giga Braun Group - IPG2P2S industrial

Industrial Media converter bridge-gigabit POE+ cu doua porturi SFP & doua porturi PoE+,
Industrial Switch 2*10/100/1000 PoE + 2 Gigabit SFP, Industrial, 802.3 af/at, puterea maxima =30W/ port, output voltage DC 48-57V ;
Industrial temperature range;   DIN RAIL; PoE Power nu este inclusa

Pret : 631.24 RON
*) Pretul nu contine TVA
cuTVA: 751.17 RON
Disponibilitate : Sunati
IPS33064PF-at6-Port Industrial PoE Switch Braun Group - IPS33064PF-at

6-port Industrial Gigabit PoE Switch with 4PoE Ports and 2 Gigabit Fiber Ports

Pret : 762.40 RON
*) Pretul nu contine TVA
cuTVA: 907.26 RON
Disponibilitate : Sunati
5 Ports Gigabit PoE Switch4POE+ Gigabit switch 6port * 10/100/1000 switch,UpLink Giga-Cu&SFP,48V 2A Power Braun Group - GP411-96W
Switch gigabit 4*PoE+ cu uplink de fibra ( SFP slot) si RJ45 ( cupru); sursa PoE 96Watt.
With 4*10/100/1000Mbos PoE+ Ports ( max30W/port), comply with IEEE 802.3at PoE standard; 1*10/100/1000Mbps Up-Link port and 1 Gigabit SFP fiber injector, providing power and faster Ethernet for Wireless Access Point, IP Camera, IP Phone
Pret vechi 236.16 RON
Pret nou
213.06 RON
*) Pretul nu contine TVA
cuTVA: 253.54 RON
Disponibilitate : Sunati
IPS31108PF-at10-Port Industrial PoE Switch Braun Group - IPS31108PF-at

10-Port Industrial PoE Switch, 2x 100/1000Base SFP fiber combo port sockets

Pret : 1,732.73 RON
*) Pretul nu contine TVA
cuTVA: 2,061.95 RON
Disponibilitate : Sunati
UTP3-PFD01PoE Finder Tester - verificator POE alimentarea pe FTP/UTP a camerelor POE 48V UTEPO - UTP3-PDF01

Verifica daca este furnizata tensiunea PoE la capatul cablului si daca sunt corecte conexiunile:
The PoE finder detects the existence of PoE power supply and the proper functioning of PoE, which simplify the detection and recognition for PoE network. It differentiates between midspan (
4/5, /7/8) and end-span(1/2, /3/6) PoE power supply & supports IEEE802.3af/at with initiative and passive PoE

Pret vechi 50.83 RON
Pret nou
35.42 RON
*) Pretul nu contine TVA
cuTVA: 42.15 RON
Disponibilitate : Sunati
POE-172Single-Port 10/100/1000Mbps Ultra PoE Injector (60W) Planet - POE-172

PLANET POE-172 Ultra Power over Ethernet Injector provides a maximum of 60watt power and high-speed Ethernet data connection anywhere in your network infrastructure.

Pret vechi 227.45 RON
Pret nou
159.15 RON
*) Pretul nu contine TVA
cuTVA: 189.39 RON
Disponibilitate : Sunati
TEG3210PSwitch PoE cu management 8G+2SFP Tenda - TEG3210P V1.0

TEG3210P, Tenda 8G+2SFP Managed PoE Switch is right for remote Gigabit wireless cabling and HD monitoring network. Besides with access of high performance, it provides 8 10/100/1000 Base-T Ethernet ports and 2 extra independent 1000Base-X Gigabit SFP ports. Ports 1~8 support IEEE 802.3af PoE (15.4W) or 802.3at PoE+ (30W) standard; up to 40W power output per PoE port; and can supply electricity to high-power PDs such as dual band/11AC devices; supply electricity and transmit data at the same time to AP, IP Camera or IP Phone via Cat.5 twisted-pair cables. In addition to these, it provides stronger safety protection system, improved QoS policy, multiple VLAN features and higher availability of maintenance. To sum up, Tenda 8G+2SFP Managed PoE Switch is an ideal and safe switch for easy use.

Pret vechi 605.81 RON
Pret nou
446.66 RON
*) Pretul nu contine TVA
cuTVA: 531.52 RON
Disponibilitate : In stoc
POE-151-EUIEEE 802.3af POE Injector (Mid-Span) Planet - POE-151-EU

IEEE 802.3af Power Over Ethernet Injector (Mid-Span)

Pret : 111.30 RON
*) Pretul nu contine TVA
cuTVA: 132.45 RON
Disponibilitate : Sunati
IPS33064PF6-Port Industrial PoE Switch Braun Group - IPS33064PF

6-port Industrial Gigabit PoE Switch with 4PoE Ports and 2 Gigabit Fiber Ports

Pret : 677.69 RON
*) Pretul nu contine TVA
cuTVA: 806.45 RON
Disponibilitate : Sunati
MDP4P1RPOE Switch Metal Desk PoE (10/100) with 4POE + 1*Rj45 uplink Braun Group - MDP4P1R

POE Switch   == Metal Desk PoE (10/100) with 4POE + 1*Rj45 uplink, cu alimentator incorporat

Pret : 138.62 RON
*) Pretul nu contine TVA
cuTVA: 164.96 RON
Disponibilitate : Sunati
IPS31108PF10-Port Industrial PoE Switch Braun Group - IPS31108PF

10-Port Industrial PoE Switch, 2x 100/1000Base SFP fiber combo port sockets

Pret : 1,432.39 RON
*) Pretul nu contine TVA
cuTVA: 1,704.54 RON
Disponibilitate : Sunati
GSD-1008HP8-Port 10/100/1000T 802.3at PoE + 2-Port 10/100/1000T Desktop Switch Planet - GSD-1008HP

PLANET GSD-1008HP provides eight 10/100/1000T ports featuring 30-watt 802.3at PoE+, a total 120-watt PoE budget and extra two uplink ports to fulfill the demand of sufficient PoE power for HD IP surveillance and Wi-Fi system in a small-scale but high-performance network. With the same desktop-sized and compact metal housing, it makes the placement of the unit convenient and provides a quick and easy PoE PDs deployment with power feeding.

Pret vechi 469.41 RON
Pret nou
395.32 RON
*) Pretul nu contine TVA
cuTVA: 470.43 RON
Disponibilitate : Sunati
IPS31108PF-M10-Port Managed Industrial PoE Switch Braun Group - IPS31108PF-M

10-Port Industrial PoE Switch, 2x 100/1000Base SFP fiber combo port sockets.


Pret : 1,771.23 RON
*) Pretul nu contine TVA
cuTVA: 2,107.77 RON
Disponibilitate : Sunati
MFP4P1RPOE Switch Metal Flanche PoE (10/100) with 4POE + 1*Rj45 uplink Braun Group - MFP4P1R

POE Switch   == Metal Flanche PoE (10/100) with 4POE + 1*Rj45 uplink, cu alimentator

Pret : 153.51 RON
*) Pretul nu contine TVA
cuTVA: 182.67 RON
Disponibilitate : Sunati
IPS31096PF-at9-Port Industrial PoE Switch Braun Group - IPS31096PF-at

9-port Industrial PoE Switch with 6 PoE Ports and 3 Gigabit Fiber Ports

Pret : 3,473.16 RON
*) Pretul nu contine TVA
cuTVA: 4,133.06 RON
Disponibilitate : Sunati
9 Ports PoE Switch9 Ports faster Poe switch with 120W Poe Power Braun Group - FP801H

with 9 auto-negotiation,auto MDI/MDIX RJ45 ports,1-8 ports support IEEE 802.3af/at PoE standard, plug and play; With the innovative energy-efficient technology, users can choose the PoE switch according power consumption, making it an eco-friendly solution for home/business networking.

Pret : 313.17 RON
*) Pretul nu contine TVA
cuTVA: 372.68 RON
Disponibilitate : Sunati
G1024DIPCOM Switch gigabit 24P rack-mount protectie fulgere 6kV, 2000Mbps/port, 3years warranty IP-COM - G1024D
24-Ports Gigabit Switch, 24 * 10/100/1000M RJ45 ports, unmananged plug & play.
Lightning protection for each port up to 6KV.
8K MAC address table; 1U 13-inch rack-mountable steel case, fanless design.
IPcom provides 3years warranty
Pret vechi 362.83 RON
Pret nou
305.54 RON
*) Pretul nu contine TVA
cuTVA: 363.59 RON
Disponibilitate : Sunati
IPS31096PF9-Port Industrial PoE Switch Braun Group - IPS31096PF

9-port Industrial PoE Switch with 6 PoE Ports and 3 Gigabit Fiber Ports

Pret : 3,065.00 RON
*) Pretul nu contine TVA
cuTVA: 3,647.36 RON
Disponibilitate : Sunati
IPX8P2RPOE switch 8 PorturiPoE Braun Group - IPX8P2R

Switch 8*10/100 PoE + 2*10/100 Uplink Industrial, 802.3 af/at, 1 port max 30W, IP40, DC 48-57V 

Pret : 564.74 RON
*) Pretul nu contine TVA
cuTVA: 672.04 RON
Disponibilitate : Sunati
G1016DIPCOM Switch Gigabit 16 port rack-mount, protectie fulgere 6kV, 3 ani garantie (TEG1016D) IP-COM - G1016D
16-Ports Gigabit Switch, 16 * 10/100/1000M RJ45 ports, 1U 13-inch rack-mountable steel case. Lightning protection on its ports up to 6KV.
8K MAC address table
IPcom provides 3years warranty
Pret vechi 253.56 RON
Pret nou
217.48 RON
*) Pretul nu contine TVA
cuTVA: 258.81 RON
Disponibilitate : Sunati
9 Ports PoE Switch8Poe FE-9Port 10/100 Switch ,Uplink port,96W,Poe Power Braun Group - FP801

With 9 auto-negotiation,auto MDI/MDIX RJ45 ports,1-8 ports support IEEE 802.3af/at PoE standard, plug and play; With the innovative energy-efficient technology, users can choose the PoE switch according power consumption, making it an eco-friendly solution for home/business networking

Pret : 272.10 RON
*) Pretul nu contine TVA
cuTVA: 323.80 RON
Disponibilitate : Sunati
IPS31096PF-M9-Port Managed Industrial PoE Switch Braun Group - IPS31096PF-M

9-port Industrial PoE Switch with 6 PoE Ports and 3 Gigabit Fiber Ports.


Pret : 3,473.16 RON
*) Pretul nu contine TVA
cuTVA: 4,133.06 RON
Disponibilitate : Sunati
TEG1009P-EISwitch desktop 9 porturi Gigabit cu 8 porturi PoE Tenda - TEG1009P-EI

Tenda TEG1009P-EI is 9-Port Gigabit Desktop Switch with 8-Port PoE, providing 9 GE Base-T Ethernet ports. 1-8 ports supports IEEE802.3af PoE(15.4W) or 4 ports 802.3at PoE(30W). Through conventional Cat 5 twisted pair, power can be transmitted along with data for AP, IP Camera and IP Phone. Plus, the device complies with 802.3az(EEE) standard, and is designed with superior performance such as 9th uplink port for lightning protection, PoE dynamic power, lower power consumption and fan-less. Thus, Wireless coverage, safety project, difficult power supply of end-device, maintenance hassle are effectively solved, TEG1009P is ideal for you to lower cost greatly.

Pret : 474.90 RON
*) Pretul nu contine TVA
cuTVA: 565.13 RON
Disponibilitate : In stoc
F1024 V5.0IPCOM Switch 24Port 10/100M rack-19'', protectie fulgere 6kV, 3 ani garantie -8k Mac (TEF1024) IP-COM - F1024 V5.0
24-Ports 10/100M Unmanaged Switch, 1U 19-inch rack-mountable steel case , 8K MAC Address Table;
Support MAC address Self learning  Auto MDI/MDIX, broadcast storm protection, buffer zone auto distribution;
Metal Housing, internal PSU, green energy saving >30% power consumption
Pret vechi 157.01 RON
Pret nou
122.00 RON
*) Pretul nu contine TVA
cuTVA: 145.18 RON
Disponibilitate : Sunati
G3224T 24-Port Gigabit Web-smart SwitchSwitch optic smart IPCOM 26 port gigabit cu 24 port giga Cupru + 2 SFP, Layer 2, 3 ani garantie IP-COM - G3224T

G3224T is GE layer 2 and non-blocked switch, designed for building high-performance GE networking. Provide 24 10/100/1000Mbps autosensing RJ45 ports and 2 GE fiber ports. Provide comprehensive security defense system, QoS and VLAN, hardware for layer 2 wire-speed switching. With powerful security capacity and rich features, the device can meet various application needs for large-sized businesses, bars, parks and data center.

Pret : 631.24 RON
*) Pretul nu contine TVA
cuTVA: 751.17 RON
Disponibilitate : Sunati
FSD-604HP 4-Port 10/100TX 802.3af/at4-Port 10/100TX 802.3af/at PoE + 2-Port 10/100TX Desktop Switch Planet - FSD-604HP

PLANET FSD-604HP Desktop Switch provides four 802.3at PoE+ ports for catering to small-scale IP surveillance networks at a lower total cost. With dual 10/100BASE-TX uplink ports, the recorded HD video files from the 4 PoE IP cameras powered by the FSD-604HP are saved in the 4-channel NVR system.

Pret : 150.02 RON
*) Pretul nu contine TVA
cuTVA: 178.52 RON
Disponibilitate : In stoc
PE61055 Port Fast Ethernet PoE Switch/4 Port PoE/802.3at/af, sursa PoE 48V 1.25A externa Netis - PE6105

The netis PE6105 Fast Ethernet PoE Switch provides a great selection for expanding your home or office network. It provides 5 10/100Mbps RJ45 ports , port 1 to port 4 support Power over Ethernet(PoE) function. It can automatically detect and supply power with the IEEE 802.3at/af compliant Powered Devices (PDs), like PoE APs, IP Phones,IP cameras, etc.In this case, the electrical power is transmitted along with data in one single cable allowing you to expand your network to where there are no power lines or outlet
Vezi si proudus echivalent, F1105P IPcom,

Pret : 116.70 RON
*) Pretul nu contine TVA
cuTVA: 138.87 RON
Disponibilitate : Sunati
MPX4P1FSPOE Switch Metal Desk PoE (10/100) with 4POE + 1*Fiber SM module 155M Braun Group - MPX4P1FS

POE Switch   == Metal Desk PoE (10/100) with 4POE + 1*Fiber SM module 155M, cu alimentator

Pret : 231.03 RON
*) Pretul nu contine TVA
cuTVA: 274.93 RON
Disponibilitate : Sunati
MPG7P1GPOE Switch Metal Desk PoE (10/100) with 4POE + 1*Fiber SM module 155M Braun Group - MPG7P1G

POE Switch   ==Metal PoE-switch Gigabit with 7PoE giga+1*Giga Uplink, desktop, cu alimentator

Pret : 415.86 RON
*) Pretul nu contine TVA
cuTVA: 494.87 RON
Disponibilitate : Sunati
MPG4P2GGigabit POE switch 4 PorturiPoE Braun Group - MPG4P2G

Switch 4*10/100/1000 PoE + 2*10/100/1000 Uplink, 802.3 af/at, fiecare port suporta max 15,4W ( mod 802.3af ) sau max 30W ( mod 802.3at ), cu alimentator inclus

Pret : 302.91 RON
*) Pretul nu contine TVA
cuTVA: 360.46 RON
Disponibilitate : Sunati
front8-Port 10/100TX 802.3at PoE + 1-Port 10/100/1000T + 1-Port 100/1000X SFP Desktop Switch (120 watts) Planet - FGSD-1011HP

8-Port 10/100TX 802.3at PoE + 1-Port 10/100/1000T + 1-Port 100/1000X SFP Desktop Switch (120 watts)

Pret : 387.14 RON
*) Pretul nu contine TVA
cuTVA: 460.70 RON
Disponibilitate : Sunati
frontSwtich L2+ 24-Port 10/100/1000T Ultra PoE + 4-Port 10G SFP+ cu Management si LCD touch screen Planet - GS-5220-24UP4XV

L2+/L4 24-Port 10/100/1000T 802.3at PoE + 4-Port 10G SFP+ Managed Switch with Color LCD Touch Screen, Hardware Layer3 IPv4/IPv6 Static Routing (400W PoE Budget, ONVIF)

Pret : 3,973.73 RON
*) Pretul nu contine TVA
cuTVA: 4,728.74 RON
Disponibilitate : Sunati
24-Port 10/100/1000T 802.3at PoE + 2-Port 100/1000X SFP Managed SwitchSwitch Layer2, PoE 10/100/1000T 802.3at +2port SFP -24-Port Gigabit Planet - GS-4210-24P2S

 24-Port 10/100/1000T 802.3at PoE + 2-Port 100/1000X SFP Managed Switch

Pret vechi 1,548.58 RON
Pret nou
1,370.73 RON
*) Pretul nu contine TVA
cuTVA: 1,631.17 RON
Disponibilitate : Sunati
E2021-Port 802.3at PoE+ to 2-Port 802.3af/at Gigabit PoE Extender Planet - POE-E202

Injector/Repetor POE, 1 port 802.3at PoE+ la 2 porturi POE Gigabit 802.3af/at.

Pret : 241.97 RON
*) Pretul nu contine TVA
cuTVA: 287.94 RON
Disponibilitate : Sunati
FSD-1008HP8-Port 10/100TX 802.3at PoE + 2-Port 10/100TX Desktop Switch Planet - FSD-1008HP

PLANET FSD-1008HP provides eight 10/100TX ports featuring 30-watt 802.3at PoE+, a total 120-watt PoE budget and extra two uplink ports to fulfill the demand of sufficient PoE power for HD IP surveillance and Wi-Fi system in a small-scale but high-performance network. With the same desktop-sized and compact metal housing, it makes the placement of the unit convenient and provides a quick and easy PoE PDs deployment with power feeding.

Pret : 324.23 RON
*) Pretul nu contine TVA
cuTVA: 385.84 RON
Disponibilitate : Sunati
POE-171SSingle-Port 10/100/1000Mbps Ultra PoE Splitter (12V/19V/24V) Planet - POE-171S

PoE Splitter -56V, tensiune iesire 12V; 9V; 24V
Receptor adaptor PoE, se conformeaza IEEE 802.3at/af, permite transfer de date si de energie pe acelasi cablu pana la 100m, carcasa plastic, format de buzunar, plug and play, RoHS:

Pret : 266.16 RON
*) Pretul nu contine TVA
cuTVA: 316.73 RON
Disponibilitate : Sunati
POE-171Single-Port 10/100/1000Mbps Ultra PoE Injector (60 Watts) Planet - POE-171

POE injector gigabit: 1 port PoE, se conformeaza IEEE 802.3at/af, permite transfer de date si de energie pe acelasi cablu pana la 100m, carcasa metal, format de buzunar, plug and play, RoHS.

Pret : 241.97 RON
*) Pretul nu contine TVA
cuTVA: 287.94 RON
Disponibilitate : Sunati
TL-SF1005DSwitch desktop 4-porturi PoE +1 port 10/100M TP-Link - TL-SF1005P

Switch desktop 5-porturi 10/100M, 4 porturi POE, carcasa metalica

Pret : 147.00 RON
*) Pretul nu contine TVA
cuTVA: 174.93 RON
Disponibilitate : Sunati
SL2428P24-Port 10/100Mbps PoE+, + 4-Port Gigabit + 2-Port SFP Smart Switch TP-Link - T1500-28PCT(TL-SL2428P)

24-Port 10/100Mbps PoE + 4 Gigabit RJ45 Ports and 2 Combo SFP Slots, Smart Switch, 802.3at/af, 180W PoE power supply, Tag-based VLAN, STP/RSTP/MSTP, IGMP V1/V2/V3 Snooping, 802.1P QoS, Rate Limiting, Port Trunking, Port Mirroring, SNMP, RMON, 1U 19-inch rack-mountable steel case

Pret : 954.00 RON
*) Pretul nu contine TVA
cuTVA: 1,135.26 RON
Disponibilitate : Sunati
GSD-1222VHPSwitch Gigabit 8-Port PoE + 2-Port 10/100/1000T + 2-Port 1000X SFP, Monitor LCD Planet - GSD-1222VHP

Switch Gigabit 8-Port PoE + 2-Port 10/100/1000T + 2-Port 1000X SFP, Monitor LCD, 120W

Pret : 716.22 RON
*) Pretul nu contine TVA
cuTVA: 852.30 RON
Disponibilitate : Sunati
GS-4210-24P4CSwitch POE Gigabit 24 port + 4 port Combo TP/SFP (220W) Planet - GS-4210-24P4C

24-Port 10/100/1000T 802.3at PoE + 4-Port Gigabit TP/SFP Combo Managed Switch

Pret : 1,790.54 RON
*) Pretul nu contine TVA
cuTVA: 2,130.74 RON
Disponibilitate : Sunati
US-24-250WUbiquiti US-24-250W 24-port + 2xSFP Gigabit PoE 250W UniFi switch Ubiquiti - US-24-250W

Ubiquiti US-24-250W 24-port + 2xSFP Gigabit PoE 250W UniFi switch

Pret : 1,914.92 RON
*) Pretul nu contine TVA
cuTVA: 2,278.75 RON
Disponibilitate : Sunati
US-8-150WUbiquiti US-8-150W 8-port + 2xSFP Gigabit PoE+ or 24V passive 150W UniFi switch Ubiquiti - US-8-150W

Ubiquiti US-8-150W 8-port + 2xSFP Gigabit PoE+ or 24V passive 150W UniFi switch

Pret : 938.90 RON
*) Pretul nu contine TVA
cuTVA: 1,117.29 RON
Disponibilitate : Sunati
US-16-150WUbiquiti US-16-150W 16port + 2xSFP Gigabit PoE+ or 24V passive 150W UniFi switch Ubiquiti - US-16-150W

Ubiquiti US-16-150W 16port + 2xSFP Gigabit PoE+ or 24V passive 150W UniFi switch

Pret : 1,368.56 RON
*) Pretul nu contine TVA
cuTVA: 1,628.59 RON
Disponibilitate : Sunati
GSW-2620Switch POE Gigabit 24 port + 2 port SFP (220W) Planet - GSW-2620HP

24-Port 10/100/1000T 802.3at PoE + 2-Port Gigabit SFP Switch

Pret : 1,088.84 RON
*) Pretul nu contine TVA
cuTVA: 1,295.72 RON
Disponibilitate : Sunati
US-48-500WUbiquiti US-48-500W 48-port + 2xSFP, 2xSFP+ Gigabit PoE 500W UniFi switch Ubiquiti - US-48-500W

Ubiquiti US-48-500W 48-port + 2xSFP, 2xSFP+ Gigabit PoE 500W UniFi switch

Pret : 3,656.92 RON
*) Pretul nu contine TVA
cuTVA: 4,351.73 RON
Disponibilitate : Sunati
GSW-2620VHPSwitch POE Gigabit 24 port + 2 port Gigabit SFP si montor LCD (300W) Planet - GSW-2620VHP

Switch POE Gigabit 24 port + 2 port Gigabit SFP si montor LCD (300W)

Pret : 1,355.00 RON
*) Pretul nu contine TVA
cuTVA: 1,612.45 RON
Disponibilitate : Sunati
POE-E2011-Port 802.3at Gigabit POE+ Repetor (Extender) - 26W Planet - POE-E201

IEEE802.3at Gigabit POE+ Repeater (Extender) - High Power POE

Pret : 225.03 RON
*) Pretul nu contine TVA
cuTVA: 267.78 RON
Disponibilitate : Sunati
POE E1011-Port 802.3af Ethernet POE Extender Planet - POE-E101

Extender POE, 1 port 802.3af PoE Fast Ethernet (10/100M) 

Pret : 174.21 RON
*) Pretul nu contine TVA
cuTVA: 207.32 RON
Disponibilitate : Sunati
front24 PoE 10/100/1000 Base-T port + 4 TP/SFP Combo Ports D-Link - DGS-1210-24P

Switch POE 24 x 10/100/1000BaseT + 4 x TP/SFP Combo port, buget POE 193W

Pret : 1,709.63 RON
*) Pretul nu contine TVA
cuTVA: 2,034.46 RON
Disponibilitate : Sunati
front26-Port Gigabit Max PoE Smart Managed Switch including 2 comb ports (24 x PoE ports, 370W PoE budget, fan) D-Link - DGS-1100-26MP

Switch POE 26-port - 24 x 10/100/1000BaseT + 2 x SFP Combo port, management, buget POE 370W. 

Pret : 2,151.15 RON
*) Pretul nu contine TVA
cuTVA: 2,559.87 RON
Disponibilitate : Sunati
front10-Port Gigabit Max PoE Smart Managed Switch including 2 SFP ports (8 x PoE ports, 130W PoE budget, fan) D-Link - DGS-1100-10MP

Switch POE 10-port - 8 x 10/100/1000BaseT + 2 x SFP port, management, buget POE 130W. 

Pret : 1,185.96 RON
*) Pretul nu contine TVA
cuTVA: 1,411.29 RON
Disponibilitate : Sunati
FGSW-2511PSwitch 24-Port 10/100TX PoE + 1-Port Gigabit TP/SFP Combo (190W) Planet - FGSW-2511P

24-Port 10/100TX 802.3at PoE + 1-Port Gigabit TP/SFP combo Ethernet Switch (190W PoE Budget, Standard/ VLAN/ QoS/ Extend mode).


Pret vechi 803.32 RON
Pret nou
718.76 RON
pret per bucata
*) Pretul nu contine TVA
cuTVA: 855.33 RON
Disponibilitate : In stoc
front52-Port PoE Gigabit Smart Switch - 48 x PoE 10/100/1000Mbps - 4 x Combo 10/100/1000BaseT/SFP Port D-Link - DGS-1210-52MP

Switch Smart POE 52-Port - 48 x PoE 10/100/1000Mbps - 4 x Combo 10/100/1000BaseT/SFP Port, buget POE: 370W

Pret : 3,886.45 RON
*) Pretul nu contine TVA
cuTVA: 4,624.87 RON
Disponibilitate : Sunati
SG1005PSwitch Gigabit 4-porturi PoE +1 port 10/100/1000M TP-Link - TL-SG1005P

Switch desktop 5-porturi 10/100/1000M, 4 porturi POE, carcasa metalica

Pret : 195.00 RON
pret per bucata
*) Pretul nu contine TVA
cuTVA: 232.05 RON
Disponibilitate : In stoc
9 Port Fast Ethernet PoE Switch/ 4 Port PoE/ 802.3at/af9 Port POE Switch/ 4 Port PoE + 5Port*10/100, 802.3at/af, sursa externa 48V 1.25A, flansa Netis - PE6109H

Switch PoE on the field, compact, cu flanse, cu posibilitate montare pe perete sau in dulapuri mici, cu sursa externa
The netis PE6109H Fast Ethernet PoE Switch provides a great selection for expanding your home or office network. It provides 9 10/100Mbps RJ45 ports , port 6 to port 9 support Power over Ethernet(PoE) function. It can automatically detect and supply power with the IEEE 802.3at/af compliant Powered Devices (PDs), like PoE APs, IP Phones,IP cameras, etc.In this case, the electrical power is transmitted along with data in one single cable allowing you to expand your network to where there are no power lines or outlets.

Pret : 166.98 RON
*) Pretul nu contine TVA
cuTVA: 198.71 RON
Disponibilitate : In stoc
SGS-5220-24P2XSwitch Gigabit Stackabil 24-Port PoE+ plus 2-Port 10G SFP+ (380W) Planet - SGS-5220-24P2X

Switch Gigabit Stackabil 24-Port PoE+ plus 2-Port 10G SFP+, management, stackabil pana la 16 unitati

Hardware Stacking / IPv6 / 802.1Q VLAN / Q-in-Q / MSTP / IGMP Snooping / ACL / RADIUS / TACACS+ / SSH / SSL / SNMPv3 / POE

Pret : 3,193.94 RON
pret per bucata
*) Pretul nu contine TVA
cuTVA: 3,800.79 RON
Disponibilitate : Sunati
POE-161Injector POE IEEE 802.3at Gigabit (30W) Planet - POE-161

Injector POE, IEEE 802.3at, 10/100/1000Mbps, maxim 30W/port, 

Pret : 140.34 RON
pret per bucata
*) Pretul nu contine TVA
cuTVA: 167.00 RON
Disponibilitate : In stoc
TL-SL1218MP16-Port 10/100 Mbps + 2-Port Gigabit Rackmount Switch with 16-Port PoE+ TP-Link - TL-SL1218MP

PORT: 16× 10/100 Mbps PoE+ Ports, 2× Gigabit Non-PoE Ports, 2× Combo Gigabit SFP Slots
HARDWARE: 802.3at/af, 192 W PoE Power, 1U 19-inch Rack-mountable Steel Case
FEATURE: Extend Mode for 250 m PoE Transmitting, Priority Mode for Port 1-8, Plug and Play

Pret : 748.00 RON
*) Pretul nu contine TVA
cuTVA: 890.12 RON
Disponibilitate : Sunati
T1500G-10PS (TL-SG2210P)JetStream 8-Port Gigabit Smart PoE+ Switch with 2 SFP Slots TP-Link - T1500G-10PS(TL-SG2210P)

JetStream™ 10-Port Gigabit Smart Switch with 8-Port PoE
PORT: 8× Gigabit PoE Ports, 2× Gigabit SFP Slots
SPEC: 802.3af, 53 W PoE Power, Desktop Steel Case
FEATURE: 802.1Q VLAN, STP/RSTP/MSTP, IGMP Snooping, 802.1p/DSCP QoS, ACL, 802.1x, Radius/Tacacs+ Authentication, LACP, CLI, SNMP, Dual Image, IPv6

Pret : 443.00 RON
*) Pretul nu contine TVA
cuTVA: 527.17 RON
Disponibilitate : Sunati
WGS-814HPSwitch Industrial Wall Mount 8 porturi gigabit/4 porturi POE+ (60W) Planet - WGS-814HP

8-Port 10/100/1000T Wall Mounted Gigabit Ethernet Switch with 4-Port PoE+

Sursa alimentare: 54V / 72W - inclusa.

Pret : 527.48 RON
*) Pretul nu contine TVA
cuTVA: 627.71 RON
Disponibilitate : Sunati
T1500G-10MPSJetStream 8-Port Gigabit Smart PoE+ Switch with 2 SFP Slots TP-Link - T1500G-10MPS

JetStream™ 10-Port Gigabit Smart Switch with 8-Port PoE+
PORT: 8× Gigabit PoE+ Ports, 2× Gigabit SFP Slots
SPEC: 802.3at/af, 116 W PoE Power, 1U 13-inch Rack-mountable Steel Case,
FEATURE: 802.1Q VLAN, STP/RSTP/MSTP, IGMP Snooping, 802.1p/DSCP QoS, ACL, 802.1x, Radius/Tacacs+ Authentication, LACP, CLI, SNMP, Dual Image, IPv6

Pret : 679.00 RON
*) Pretul nu contine TVA
cuTVA: 808.01 RON
Disponibilitate : Sunati
Preturile nu contin TVA
Utiliz─âm cookie-uri pentru a ├«mbun─ât─â╚Ťi experien╚Ťa site-ului ╚Öi pentru a analiza traficul ╚Öi publicul pe site. Continu├ónd s─â naviga╚Ťi pe site-ul nostru, sunte╚Ťi de acord cu acceptarea utiliz─ârii cookie-urilor ├«n conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale ╚Öi a╚Ťi notat Not─â de procesare a informa╚Ťiilor personale. Accept