Curs valutar


1 EURO = 4.7315 RON  
1 USD = 4.2103 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20km


 » Stabilizatoare de tensiune trifazice 380V


Stabilizator de tensiune trifazic cu servomotor 15kVA

Braun Group - ES-SVC 15KVA-380

Stabilizator de tensiune trifazic cu servomotor. Putere maxima 15kVA. Ui: 276VAC-450VAC; Uo: 380VAC; precizie<3%; cu bypass manual

Nota: Puterea utila in W este jumatate din puterea in VA doar in cazul limita cand tensiunea la intrare este la nivelul minim acceptat.

Pret fara TVA:
2,114.98 RON

Pret cu TVA :
2.516,83 RON

Disponibilitate :


Main Features: 

+ Three phase compensation servo motor technology
+ Wide AC input voltage range 276-450V
+ 100% unbalanced loading capability between three phases
+ Digital display for voltage and current
+ Isolated manual bypass switch
+ Full protections such as over voltage, under voltage, overload, overheat, etc
+ Selectable 6s/180s output delay
+ Optional surge/spike protection (replaceable SPD)
+ Optional output isolation transformer
+ Optional RS232/RS485
Typical Applications: 

+ Multi-color printing machines
+ Air compressors
+ CNC machines
+ Punching machines
+ Laser cutting machines
+ Welding machines



Rated Input Voltage 380V (400V/415V Optional)
InputVoltageRange 276-450V
Input Frequency 45-65Hz
Power Factor 0.98


Rated Output Voltage 380V (400V/415V Optional)
Output Precision ±3% (±1% Optional)
Response Time <1s, against 10% variation of input voltage
Efficiency >96%


Input Voltage Line Voltage: AB, BC, CA          Phase Voltage: A, B, C
Output Voltage Line Voltage: AB, BC, CA          Phase Voltage: A, B, C
Output Current Phase Current: A, B, C


Output Under Voltage Output cutoff by contactor + "L" in display + Buzzer beeping
Output Over Voltage Output cutoff by contactor + "H" in display + Buzzer beeping
Overload Output cutoff by contactor + "F" in display + Buzzer beeping
Overheat Output cutoff by contactor + "C" in display + Buzzer beeping
Phase Failure Output cutoff by contactor + Buzzer beeping
Wrong Phase Sequence Can't switch on regulator
Short Circuit Input cutoff by air breaker
Bypass Isolated Manual Bypass Switch (Automatic Bypass Optional)
Output Delay Time 6s/180s Selectable
Surge Spike Optional, Replaceable SPD
RS232/RS485 Optional


Insulation Voltage 2,000V / 60s
Insulation Resistance >5MΩ
Creepage Distance >8mm
Grounding Resistance <0.1mΩ
Insulation Class of Coil Class F (155?)
Cooling Mode Cooling Fan
IP Level IP20
Audible Noise  


Operating Temperature -5°C - +45°C
Operating Humidity 10%-90%, non-condesing
Operating Altitude <1,000m


Model No. 10KVA 15KVA 20KVA 30KVA 45KVA 60KVA 80KVA 100KVA
Capacity 10kVA/6kW 15kVA/9kW 20kVA/12kW 30kVA/18kW 45kVA/36kW 60kVA/48kW 80kVA/64kW 100kVA/80kW
Machine Size D520 x W460 x H830 mm D600 x W520 x H1080 mm D600 x W570 x H1080 mm
N.W. 70kgs          78kgs        100kgs         108kgs 175kgs              190kgs 210kgs               235kgs
Packing Size D530 x W470 x H850 mm D610 x W530 x H1200 mm D610 x W580 x H1200 mm
G.W. 80kgs          88kgs         110kgs        118kgs 190kgs              205kgs 228kgs               253kgs 

*Nota: Fotografiile sunt cu caracter general si nu creeaza obligatii contractuale.
Produsul poate arata diferit in realitate.
Specificatiile pot fi schimbat fara preaviz.

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept