Curs valutar


1 EURO = 4.7791 RON  
1 USD = 4.2931 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlan


 » Routere wireless


Router gigabit dualband N1-AC1200, USB (4G/FTPserver), 4+1 port gigabit, ipv6, ‎AP, Repeater, AP+WDS, WDS, client..N1 netis

Netis - N1 AC1200 4G, 2019

Model 2019 , 3G/4G via USB & media server
Routerul N1, echipat cu tehnologia Wi-Fi de 802.11AC de ultima generatie, va ofera conexiune simultana in banda dubla cu viteze wireless de 867Mbps pe banda de 5GHz si 300Mbps pe banda de 2,4 GHz, ideala pentru un download mai rapid, jocuri online, apeluri internet și streaming video HD. De asemenea, acesta oferă porturi full gigabit care sunt de 10 ori mai rapide decât conexiunile convenționale Fast Ethernet.

Alte imagini:

Pret vechi fara TVA :
140,29 RON

Pret nou fara TVA :
130,45 RON
Reducere: 7%

Pret nou cu TVA :
155,23 RON

Disponibilitate :
In stoc

  • · Works seamlessly with all 802.11a/b/g/n/ac devices
    · Simultaneous 2.4GHz 300Mbps and 5GHz 867Mbps connections
    · Various WAN connection types in AP Router mode- DHCP, Static IP, PPPoE, L2TP, PPTP, Russia PPPoE/PPTP/L2TP, WISP
    · Multiple wireless modes- AP, Repeater, AP+WDS, WDS, Client 
    · Multi-SSID providing up to 4 additional separate networks for guests and friends
    · 2* 5dBi high gain antennas
    · Easy wireless security setup at a push of the WPS button
    · Intelligent bandwidth control to manage the bandwidth usage for each computer reasonably
    · Internet Access Control- IP filtering, MAC Filtering, Domain Filtering based on time
    · Complete Gigabit ports ensuring high speed Ethernet connection
    · Quick setup, with built-in multilingual management page


Standards IEEE 802.11b/g/n 2.4GHz
IEEE 802.11a/n/ac 5GHz
Signal Rate Up to 300Mbps2.4GHz
UP to 867Mbps 5GHz
Frequency Range 2.4-2.4835GHz;5.180-5.825GHZ
Transmit Power 20dBm(MAX)
Data Transfer Rate 802.11ac:
80MHZ(433Mbps, 867Mbps)
802.11n: 40MHz(300Mbps, 270Mbps, 240Mbps, 180Mbps, 120Mbps, 90Mbps, 60Mbps, 30Mbps)
20MHz (144Mbps, 130Mbps, 115Mbps, 86Mbps, 57Mbps, 43Mbps, 28Mbps, 14Mbps) (Auto-Sense)
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
(11Mbps,9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)
Wireless Modes AP, Repeater, AP+WDS, WDS, Client, Multi-SSID
Wireless Security WEP/WPA-PSK/WPA2-PSK Encryption
Wireless MAC Filtering
Standards IEEE 802.3 10Base-T, IEEE 802.3u 100Base-TX, IEEE 802.3ab 1000Base-T
Interface 1*10/100/1000Mbps Auto MDI/MDIX RJ45 WAN port
4*10/100/1000Mbps Auto MDI/MDIX RJ45 LAN port
1* USB2.0 port
LED Indicators SYS, USB, WPS, 5G, 2.4G, WAN, LAN1~LAN4
Buttons Default, WPS
Antenna 2* external fixed 5dBi antenna
Power Supply DC 12V/1.0A(Output)
Dimensions (L x W x H ) 210x 128 x 28 mm
Others Bandwidth Control, Access Control, IPTV, Storage Sharing, FTP Server, Media Server, Virtual Server, DMZ, 
VPN Pass-through, Dynamic DNS, Static Routing, WOL, Backup & Restore
Certification FCC, CE
Environment Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
Package 1* N1
1* 12V/1.0A Power Adapter
1* Ethernet Cable
1* Quick Installation Guide (Multilingual)
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept