Curs valutar


1 EURO = 4.7790 RON  
1 USD = 4.3101 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:


 » Routere wireless


Router fibra gigabit AC1200 (port optic SFP 1.25G), 4*LAN gigabit, resigilat

Netis - WF2780F SFPport

Router AC1200 cu port optic gigabit SFP & gigabit WAN + 4LAN gigabit, compatibil cu module SFP gigabit 1.25G MM or SM fara DDMI (SFP module 1.25G nu este inclus), poate fi comandat pe fibra cu un device optic SFP gigabit imperecheat, sau pe port GE cupru RJ45

Routerul WF2780F ofera noua generatie de WI-FI la viteze gigabit cat si o noua solutie de conectare WAN prin fibra optica gigabit. Este conceput sa ofere acces la retea prin conectarea si distribuirea unei conexiuni internet prin fibra, cablu sau wireless. Designul inovativ permite utilizatorilor folosirea propriilor module minigbic (1.25G) de fibra Single Mode sau Multimode. Ofera conexiuni wireless de pana la 1200 Mbps (300Mbps N + 867 Mbps AC) cu tehnologie WI-FI 802.11AC pe 2 benzi simultane, evitand interferentele si asigurand conexiuni de incredere si viteze WI-FI de varf. In plus, ofera si mapare de porturi pentru IPTV, SNMP, IPv6, TR-069, VoIP, VPN, WPS si altele. Cu acest produs, utilizatorii pot beneficia de mai multe tipuri de aplicatii mari consumatoare de latime de banda, cum ar fi streaming video HD, transfer de fisiere de mare viteza sau conferinte.


Alte imagini:

Pret vechi fara TVA :
262,65 RON

Pret nou fara TVA :
204,97 RON

Pret nou cu TVA :
243,91 RON

Disponibilitate :


Standard IEEE802.11n/g/b;
Signal Rate 2.4GHz Up to 300Mbps
5 GHz UP to 867Mbps
Frequency Range 2.4-2.4835GHz; 5.180-5.825GHZ
Transmit Power 20dBm(MAX)
Data Transfer Rate 802.11ac:
80MHZ(433Mbps) 160MHZ(867Mbps)
40MHz(300Mbps, 270Mbps, 240Mbps, 180Mbps, 120Mbps, 90Mbps, 60Mbps, 30Mbps)
20MHz (144Mbps, 130Mbps, 115Mbps, 86Mbps, 57Mbps, 43Mbps, 28Mbps, 14Mbps) (Auto-Sense)
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
(11Mbps,9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)
Wireless Mode AP, WDS, AP+WDS, Repeater, Client, Multiple AP
Wireless Security 64/128-bit WEP,
SSID Broadcast Enable/Disable
Wireless MAC Filtering
Standards IEEE 802.3 10Base-T, IEEE 802.3u 100Base-TX,
IEEE 802.3u 1000Base-TX
Interface 1* 10/100/1000M Auto MDI/MDIX RJ45 WAN port
4* 10/100/1000M Auto MDI/MDIX RJ45 LAN port
1* 10/100/1000M Fiber port
LED Indicators PWR, WPS, SYS, 2.4G, 5G, LAN1 ~4, WAN, Fiber
Buttons WPS/Default, Power ON/OFF, Wi-Fi ON/OFF
Antenna 4 * external 5dBi antenna, omni-directional antennas
Power Supply DC 12V/1A(Output)
Dimensions (L x W x H ) 210 mm ×135mm ×31mm
WAN Type PPPoE, Static IP, DHCP(Dynamic IP), Bridged, DS-Lite, 6rd
Port Forwarding Virtual Servers, Port Triggering, UPnP, DMZ
Remote Access Telnet, TFTP, HTTP, HTTPs, SNMP, SSH, PING, TR069
Access Control IP/MAC/URL & Domain filtering
VPN Pass-through PPTP, L2TP

SNMP, IPv6, RIP, DLNA, TR069, IPTV, IGMP Snooping,

MLD Proxy & Snooping, DDNS, QOS, DOS, DHCP Relay

Certification FCC, CE
Environment Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
1 * WF2780F
1 * Quick Install Guide
1 * Power Adapter
1 * Gigabit Cable
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept