Curs valutar


1 EURO = 4.7635 RON  
1 USD = 4.3251 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvcltecasetacyberpower


 » Routere wireless

Router Modem ADSL2 Wireless TD-W8101G

Router Wireless cu Modem ADSL2

TP-Link - TD-W8101G

Wireless ADSL2+ router Wireless 54M 1 port,  Ralink + Trendchip chipset, ADSL/ADSL2/ADSL2+, Annex A, cu splitter ADSL, 2.4GHz, 802.11g/b, antena detasabila

Alte imagini:
Router Modem ADSL2 Wireless TD-W8101GRouter Modem ADSL2 Wireless TD-W8101GRouter Modem ADSL2 Wireless TD-W8101G

Pret vechi fara TVA :
68,00 RON

Pret nou fara TVA :
30,00 RON

Pret nou cu TVA :
35,70 RON

Disponibilitate :

TP-Link TD-W8101G - 54Mbps Wireless ADSL2+ Modem Router
  •  Provides an ADSL 2/2+ Modem, Wireless Access Point and One-Port Router, all in a single product
  • High compatibility with ADSL services, update the old Modem you rent from your ADSL provider
  • Easy Setup Assistant provides quick & hassle free installation
  • Double firewall and advanced wireless encryption safeguard your network 

What This Product Does
54Mbps Wireless ADSL2+ Modem Router TD-W8101G is a high performance modem router that provides a full rate of ADSL2+ standard with the superb reliability and a cost-effective solution for home and small business. It is a 3-in-1 device that combines the function of a high-speed DSL modem, a One-Port 10/100Mbps NAT router and a wireless G access point. Using the TD-W8101G, you can easily create a secure and high-speed wireless network to share files, music, photos, and printers with multiple computers.

One-Stop Solution
As a 3-in-1 device,TD-W8101G combines the functions of a high speed DSL modem, a One-Port 10/100Mbps NAT router and a wireless G access point. No need to buy a separate router and wireless access point, the TD-W8101G is designed to give you a one-stop solution to acquiring and sharing high speed Internet access over a wired/wireless network. TD-W8101G allows you to completely get rid of cable clutter of multiple devices over the desktop while at the same time helps you save the cost of procurement and the cost of device running.

High-Speed ADSL and Wireless Performance
Supporting the latest ADSL standard, the TD-W8101G provides higher performance (up to 24Mbps downstream and 3.5Mbps upstream) and longer reach from the central office of your ISP(Internet Service Provider), which gives you smooth media streaming, so you can watch TV, listen to the music, broadcast over the Internet, and experience clear Internet phone calls. Wireless G technology allows you to connect to 802.11g wireless devices at up to 54Mbps, so you can make full use of your broadband connection.

Easy to Use
The device comes with a CD with an Easy Setup Assistant that helps you step by step to complete your Internet connection, wireless network settings and security configurations. This feature allows even novice users to setup the router products without sacrificing any key features, just play the bundled AUTO-RUN CD to have your network set up quickly & hassle-free.

Advanced Network Security
The TD-W8101G provides NAT and SPI (stateful packet inspection) firewall. SPI inspects the contents of incoming packets before they are allowed in, preventing potential attacks from across the Internet. For added convenience, it supports access control based on MAC address, IP address, domain name or application so parents and network administrators can establish restricted access policies for children or staff and prevent unauthorized access to the home and office network.

Flexible Management
TD-W8101G provides the Web-based GUI and Easy Setup Assistant which could help the end users to easily manage the network. Support for remote management features such as TR-064, TR-069, TR-111 and SNMP allow the ISP to contact the TD-W8101G for automatic configuration, firmware updates and remote diagnostics, simplifying management and increasing overall effectiveness while remaining relatively transparent to the end-user. Flexible management mechanism provide users the freedom and convenience.

Quality of Service
Built-in QoS engine provides multiple priority policies that help distribute Internet traffic to enable users to experience the benefit of smooth network connection of inbound and outbound data without concern of traffic congestion. This QoS support helps users to enjoy a higher ADSL transmission, especially for applications such as Internet call, video streaming and online gaming over the Internet.

  •  High speed DSL modem, NAT router and wireless access point in one device provides one-stop networking solution 
  • 54Mbps transmission rates, better for wireless network surfing or downloading
  • QoS enables smooth IPTV streaming and lag-free online gaming
  • Easy Setup Assistant provides quick & hassle free installation
  • Wireless encryptions provide your network with active defense against security threats
  • SPI and NAT firewall protects end-user devices from potential attacks across the Internet
  • Port VLAN binds specific LAN ports and PVCs for differential services
  • Auto-reconnect keeps you online indefinitely 
Hardware Features
ADSL STANDARDS Full-rate ANSI T1.413 Issue 2, ITU-T G.992.1(G.DMT), ITU-T G.992.2(G.Lite)
ITU-T G.994.1 (G.hs), ITU-T G.995.1 , ITU-T G.996.1, ITU-T G.997.1, ITU-T K.2.1
ADSL2 STANDARDS ITU-T G.992.3 (G.dmt.bis), ITU-T G.992.4 (G.lite.bis)
INTERFACE 1 10/100Mbps RJ45 Port
1 RJ11 Port
BUTTON 1 Power On/Off Switch
ANTENNA TYPE Omni directional, Fixed, Reverse SMA
DIMENTIONS(W×D×H) 174x120x29mm
Wireless Features
Wireless MAC Filtering
Software Features
PPP over ATM (RFC 2364),
PPP over Ethernet (RFC2516),
IPoA (RFC1577/2225),
PVC - Up to 8 PVCs,
PORT FORWARDING Virtual server, DMZ, ACL(Access Control List)
QUALITY OF SERVICE QoS Remarking based on IPP/ToS, DSCP and 802.1p
Dynamic Host Configuration Protocol (DHCP), DHCP relay;
Network Address Translation (NAT); PVC/Ethernet Port Mapping
VLAN, 802.1P, Static Routing, RIP v1/v2 (optional);
DNS Relay, DDNS, IGMP snooping V1/2IGMP Multicast, UPnP
SECURITY NAT Firewall, SPI Firewall, MAC / IP / Packet / Application / URL Filtering, Denial of Service(DoS), SYN Flooding, Ping of Death
DEVICE MANAGEMENT Web Based Configuration(HTTP), Remote management, Telnet management, Command Line Interface, SSL
for TR-069, SNMP v1/2c, SNMP over EOC, Web Based Firmware Upgrade, CWMP(TR-069), Diagnostic Tools

External Splitter
RJ-11 Telephone Cable
RJ-45 Ethernet Cable
Quick Installation Guide
Resource CD
Power Adapter

SYSTEM REQUIREMENTS Microsoft® Windows® 98SE, NT, 2000, XP, Vista™ or Windows 7, MAC® OS, NetWare®, UNIX® or Linux.
ENVIRONMENT Operating Temperature: 0°C~40°C
Storage Temperature: -40°C~70°C
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept