Curs valutar

09-Jul-2020

1 EURO = 4.8406 RON  
1 USD = 4.2942 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoegigabitcablu utpz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewayplugprizawirelessterouter wireless routerac routerraspberry piaudiovideocable4 contactrcajackamikounifiraspberry pi 2 model benergytkb4k3kmxsfpddmmountableantene 24ghz802.3atmeterraftsolo10gdoor phone720pcomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectriciraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbgftp5baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2cablu ftpab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascablutvcamewradvr4ch150mmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin bgftp6bgftp6pebgutp5bgutp6bgutp3bgutp5pebgftp5pebgutp6lszhbgutp6pebgutp5lszhbgsf/utp5lsnhbgftp5lszhbgftp6lszhbgf/ftp6abgf/ftp6apebgftp6alszh

ANPC

 » Routere wireless



Router Wireless Netis N2 Dual Band Gigabit AC1200

Router Wireless Netis N2 Dual Band Gigabit AC1200

Netis - N2 Netis

Routerul Netis N2 echipat cu tehnologia Wi-Fi 802.11AC va poate oferi o conexiune simultana dual band ,2,4 GHz si 5 GHz ,ideala pentru o descarcare mai rapida,jocuri online,internet,apeluri si streaming .De asemenea porturile gigabit ofera o viteza mai mare decat porturile conventionale Fast Ethernet.

Alte imagini:
Router Wireless Dual Band Gigabit AC1200Router Wireless Dual Band Gigabit AC1200Router Wireless Dual Band Gigabit AC1200
Pret fara TVA:
121.02 RON

Pret cu TVA :
144,01 RON

Disponibilitate :
Sunati

  • Works seamlessly with all 802.11a/b/g/n/ac devices
  • Simultaneous 2.4GHz 300Mbps and 5GHz 867Mbps connections
  • Various WAN connection types in AP Router mode- DHCP, Static IP, PPPoE, L2TP, PPTP, Dual Access (Russia PPPoE/PPTP/L2TP), WISP
  • Multiple wireless modes- AP, Repeater, Client 
  • Multi-SSID providing up to 6 additional separate networks for guests and friends
  • 4* 5dBi high gain antennas
  • Easy wireless security setup at a push of the WPS button
  • Intelligent bandwidth control to manage the bandwidth usage for each computer reasonably
  • Internet Access Control- IP filtering, MAC Filtering, Domain Filtering based on time
  • Complete Gigabit ports ensuring high speed Ethernet connection
  • Quick setup, with built-in multilingual management page

 

Wireless
Standards IEEE 802.11b/g/n 2.4GHz
IEEE 802.11a/n/ac 5GHz
Signal Rate Up to 300Mbps2.4GHz
UP to 867Mbps 5GHz
Frequency Range 2.4-2.4835GHz;5.180-5.825GHZ
Transmit Power 20dBm(MAX)
Data Transfer Rate 802.11ac:
80MHZ(433Mbps, 867Mbps)
802.11n: 40MHz(300Mbps, 270Mbps, 240Mbps, 180Mbps, 120Mbps, 90Mbps, 60Mbps, 30Mbps)
20MHz (144Mbps, 130Mbps, 115Mbps, 86Mbps, 57Mbps, 43Mbps, 28Mbps, 14Mbps) (Auto-Sense)
801.11g:
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
802.11b:
(11Mbps,9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)

Wireless Modes AP,  Repeater, Client, Multi-SSID
Wireless Security WEP/WPA-PSK/WPA2-PSK Encryption
Wireless MAC Filtering
Hardware
Standards IEEE 802.3 10Base-T, IEEE 802.3u 100Base-TX, IEEE 802.3ab 1000Base-T
Interface 1*10/100/1000Mbps Auto MDI/MDIX RJ45 WAN port
4*10/100/1000Mbps Auto MDI/MDIX RJ45 LAN port
LED Indicators SYS, WPS, 5G, 2.4G, WAN, LAN1~LAN4
Buttons Default, WPS
Antenna 4* external fixed 5dBi antenna
Power Supply DC 12V/1.0A(Output)
Dimensions (L x W x H ) 212 x 145 x 40 mm
Software
WAN Type DHCP, Static IP, PPPoE, L2TP, PPTP, WISP
Others Bandwidth Control, Access Control, IPTV, Virtual Server, DMZ, 
VPN Pass-through, Dynamic DNS, Static Routing,  Backup & Restore
Others
Certification FCC, CE, EAC
Environment Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
Package 1* N2
1* 12V/1.0A Power Adapter
1* Ethernet Cable
1* Quick Installation Guide (Multilingual)
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept