Curs valutar


1 EURO = 4.8393 RON  
1 USD = 4.2695 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpgigabitz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerplugprizaraspberry piaudiovideocable4 contactrcajackamikoac routerunifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin


 » Routere wireless

Router Wireless N 300Mbps Gigabit TP-Link TL-WR1042ND

Router Wireless N 300Mbps Gigabit

TP-Link - TL-WR1042ND

Router Wireless N 300Mbps Gigabit, port-uri WAN/LAN Gigabit, port USB,  suporta partajarea dispozitivelor de stocare, si ofera caracteristici de media server, server FTP si server de imprimare

Alte imagini:
Router Wireless N 300Mbps Gigabit TP-Link TL-WR1042ND
Acest produs nu mai este disponibil!
Disponibilitate :

TP-Link TL-WR1042ND - Router Wireless N 300Mbps Gigabit
Caracteristici esentiale:
  • Port-uri WAN/LAN gigabit si viteza wireless de 300Mbps, ideal pentru streaming video HD si jocuri online
  • Port USB integrat - suporta partajarea dispozitivelor de stocare, si ofera caracteristici de media server, server FTP si server de imprimare
  • Activare facila a functiei de radio wireless prin apasarea unui buton, mod simplu de configurare a securitatii prin simpla apasare a butonului WPS
  • Functia de Domain Login permite utilizatorilor sa acceseze dispozitivul prin intermediul unui nume de domeniu simplu (, în loc de a utiliza o adresa IP

Ce face acest produs

TL-WR1042ND este un router wireless N 300Mbps Gigabit, care integreaza cele mai noi tehnologii în materie de comunicatie în retea pentru a oferi utilizatorilor o experienta fantastica acasa sau la birou, în aplicatii precum cele de streaming video HD, apeluri pe Internet, partajarea de fisiere de mari dimensiuni si jocuri online. Datorita tehnologiei avansate MIMO (Multi Input Multi Output), si a caracteristicii WMM (Wi-Fi Multi Media), precum si a port-urilor Gigabit Ethernet pentru conexiuni prin fir incredibil de rapide, acest dispozitiv asigura o experienta lipsita de limitari pentru ca utilizatorii sa se poata bucura concomitent de o multitudine de aplicatii consumatoare de banda, sensibile la întreruperi. TL-WR1042ND este special echipat cu un port USB pe panoul din spate, care ofera posibilitatea implementarii unui dispozitiv de stocare, server media, server FTP sau server de imprimare. Butonul pentru activare permite utilizatorilor sa porneasca functia wireless dupa necesitati.

Port-uri Gigabit - capacitate incredibila

TL-WR1042ND integreaza un switch Gigabit Ethernet pentru capabilitati puternice de procesare a datelor, si dezlantuie potentialul maxim al standardului N, eliminând blocajele transferului între conexiunea megabit prin cablu si conexiunea wireless 11n. Toate operatiunile vor fi accelerate si eficientizate, astfel încât utilizatorii sa poata împarti fisiere de mari dimensiuni si continut video de înalta definitie într-un timp foarte scurt.

Port USB multifunctional

Configuratia routerului TL-WR1042ND cu port USB 2.0 permite utilizatorilor sa partajeze date de pe dispozitive de stocare USB sau de pe un server FTP. Utilizatorii pot partaja, de asemenea, muzica, filmele si pozele prin intermediul serverului media integrat. În plus, serverul de imprimare integrat face ca tiparirea acasa sau la birou sa fie mult mai flexibila.

Wireless N - viteza si acoperire extrema

Respectând standardul IEEE 802.11n, routerul ofera posibilitatea implementtrii unei retele wireless, asigurând o viteza de transmisie si o arie de acoperire de 18 ori, si respectiv de 6 ori mai mare decât produsele 11g conventionale. TL-WR1042ND ofera viteza necesara pentru o functionare continua a aplicatiilor intensive consumatoare de banda ca apeluri VoIP, transmisiuni video HD sau jocuri online, fara întreruperi. Datorita tehnologiei N, routerul este capabil sa minimizeze pierderile de date pe distante lungi si prin obstacole, transformând orice locuinta si spatiile adiacente într-un imens hot-spot.

Usor de utilizat

1. Buton activare/dezactivare wireless

TL-WR1042ND integreaza un buton pentru activarea/dezactivarea functiei wireless, dupa necesitati.  

2. Functia Domain Login
Aceasta functie permite utilizatorilor sa acceseze dispozitivul prin intermediul unui nume de domeniu simplu (, în loc de a utiliza o adresa IP.  

3. Configurare facila
Dispozitivul contine în pachet un disc cu Asistentul de Instalare Rapida, care va conduce prin procesul de instalare pas cu pas, oferind utilizatorilor asistenta pentru configurarea retelei wireless si a setarilor de securitate, în special celor începttori.

Configurare rapida a securitatii prin apasarea unui buton

Compatibil cu WPS (WI-FI Protected Setup™), TL-WR1042ND dispune de functia Quick Security Setup, care permite utilizatorilor sa configureze aproape instantaneu functiile de securitate prin simpla apasare a butonului WPS. Astfel va fi stabilita automat o conexiune securizata WPA2, metoda care ofera o protectie superioara cripttrii WEP. Nu numai ca aceasta metoda este mai rapida decât realizarea settrilor uzuale de securitate, dar nici nu va fi nevoie sa retinea vreo parola!

IP QoS - alocarea eficienta a latimii de banda

Într-o retea wireless, navigarea haotica pe Internet si activitatile de download intens ale utilizatorilor interni conduc de cele mai multe ori la o suprasolicitare a acesteia si la o latime de banda insuficienta. TL-WR1042ND suporta functia IP QoS, care asigura o utilizare optima a latimii de banda, prevenind congestionarile si abuzurile. În acest fel, utilizatorii unei retele mici beneficiaza de latime de banda proprie alocata, fiind diminuat impactul negativ al aplicatiilor mai putin importante asupra performantelor retelei.

  • Port-uri WAN/LAN gigabit si viteza wireless de 300Mbps, ideal pentru streaming video HD si jocuri online
  • Port USB integrat - suporta partajarea dispozitivelor de stocare, si ofera caracteristici de media server, server FTP si server de imprimare
  • Butonul Wi-Fi pentru pornire/oprire permite utilizatorilor sa activeze/dezactiveze functia wireless
  • Functia de Domain Login permite utilizatorilor sa acceseze dispozitivul prin intermediul unui nume de domeniu simplu (, în loc de a utiliza o adresa IP
  • Suporta diverse tipuri de conexiune: IP dinamic, IP static, si PPPoE
  • Suporta UPnP, DDNS, rutare statica, VPN pass-through si retransmisia datelor
  • Sistem de firewall integrat, posibilitati de filtrare dupa adresa IP, MAC sau URL pentru a asigura securitatea retelei
  • Suporta criptare WEP 64/128-biti, WPA/WPA2, WPA-PSK/WPA2-PSK
  • Controlul latimii de banda dupa adresa IP permite administratorilor sa determine latimea de banda alocata fiecarui PC
  • Controlul parental permite parintilor sau administratorilor sa stabileasca reguli de restrictionare a accesului pentru copii sau angajati
Standarde si protocoale
IEEE 802.11b, IEEE 802.11g, IEEE 802.11n
4 port-uri LAN 10/100/1000Mbps
1 port WAN 10/100/1000Mbps
1 port USB 2.0
Butoane Buton WPS
Buton pornire/oprire wireless
Buton reset
Alimentare externa 12VDC / 1.5A
Dimensiuni (lxLxH)
200 x 140 x 28mm
2*3dBi antene detasabile omnidirectionale (RP-SMA)
Rata de semnal
11b: pâna la 11Mbps(dinamic)
11g: pâna la 54Mbps(dinamic)
11n: pâna la 300Mbps (dinamic)
Putere transmisie wireless
Sensibilitate receptor 270M: -68dBm@10% PER;
130M: -69.5@10% PER
108M: -69.5@10% PER;
54M: -69.5@10% PER
11M: -85dBm@8% PER;
6M: -88dBm@10% PER
1M: -90dBm@8% PER
Functii wireless Activare/dezactivare wireless radio, Bridge WDS,
WMM, statistici wireless
Securitate wireless 64/128-biti WEP, WPA/WPA2, WPA-PSK/WPA2-PSK
Tip WAN IP Dinamic/IP Static/PPPoE/
PPTP (acces dual)/L2TP(acces dual)/BigPond
DHCP Server, client, liste clienti DHCP,
Rezervare adrese
Calitatea Serviciului WMM, controlul latimii de banda
Port Forwarding Virtual Server, Port Triggering, UPnP, DMZ
Dynamic DNS DynDns, Comexe, NO-IP
VPN Pass-Through PPTP, L2TP, IPSec (ESP Head)
Control acces Control parental, control management local,
Host List, acces programat, administrare reguli
Securitate Firewall DoS, Firewall SPI
Filtrare dupa adresa IP/Filtrare dupa adresa MAC/filtrare dupa nume domeniu
Asociere adrese IP/MAC
Management Control acces
Management local
Management la distanta
 Certificari  CE, FCC, RoHS
 Continut pachet TL-WR1042ND
2 antene detasabile omnidirectionale
Unitate alimentare
CD resurse
Ghid instalare rapida
Cerinte de sistem Microsoft® Windows® 98SE, NT, 2000, XP, Vista™ sau Windows 7, MAC® OS, NetWare®, UNIX® sau Linux.
Mediu Temperatura de operare: 0°C~40°C
Temperatura depozitare: -40°C~70°C
Umiditate de operare: 10%~90% fara condensare
Umiditate depozitare: 5%~90% fara condensare
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept