Curs valutar


1 EURO = 4.7556 RON  
1 USD = 4.2732 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte


 » Routere wireless


Router Wireless N 300Mbps 4G LTE

TP-Link - TL-MR6400

300Mbps Wireless N 4G LTE Router, build-in 4G LTE modem, support LTE-FDD/LTE-TDD/DC-HSPA+/HSPA+/HSPA/UMTS, 3x10/100Mbps LAN ports and 1x10/100Mbps LAN/WAN port, 300Mbps at 2.4GHz, 802.11b/g/n, internal LTE antennas, 2 fixed Wi-Fi antennas.


Alte imagini:
Pret fara TVA:
375.00 RON

Pret cu TVA :
446,25 RON

pret per bucata
Disponibilitate :

TP-Link TL-MR6400 - Router Wireless N 300Mbps 4G LTE
  • Partajează rețeaua LTE 4G cu mai multe dispozitive Wi-Fi și bucură-te de viteze de download de până la 150 Mbps
  • Viteze wireless N de până la 300 Mbps
  • Antenele asigură conexiuni wireless stabile
  • Nu necesită configurație - doar introduci cartelă SIM și o activezi pentru a te bucura de acces la internet de mare viteză
  • Portul LAN/WAN oferă opțiuni și flexibilitate, permițându-ți să alegi tipul de conexiune
Interfață 3 Porturi 10/100Mbps LAN,
1 port 10/100Mbps LAN/WAN,
1 Slot pentru SIM
Butoane Buton WPS/Reset, Buton Wireless Pornit/Oprit, Buton Pornit/Oprit
External Power Supply(EU) 9V/0.85A
External Power Supply(APAC) -
Dimensiuni (L x l x H) 202 x 141 x 33.6 mm
Tip antenă V3: 2 antene interne 4G LTE
V4/V2/V1: 2 antene detașabile 4G LTE
Standarde Wireless IEEE 802.11b/g/n 2.4GHz
Frecvență 2.4GHz
Rată de Semnal 300Mbps în 2.4GHz
Sensibilitate Receptor 11g 54M: -74dBm
11n HT20: -71dBm
11n HT40: -67dBm
Putere de Transmisie CE: <20dBm(2.4GHz)
Funcții Wireless Activare/Dezactivare Emisie Wireless, Bridge WDS, WMM, Statistici Wireless
Securitate Wireless 64/128-bit WEP, WPA/WPA2, criptări WPA-PSK/WPA2-PSK
Network Type (V3) 4G: FDD-LTE B1/B3/B7/B8/B20 (2100/1800/2600/900/800MHz)
TDD-LTE B38/B39/B40/B41 (2600/1900/2300/2500MHz)
3G: DC-HSPA+/HSPA+/HSPA/UMTS B1/B8 (2100/900MHz)
Network Type(APAC V3) -
Calitatea Serviciului Control Trafic (IP QoS)
Moduri Operare Router 3G/4G, Router Wireless
Management Control Acces, Management local, Management la distanță
Tip Conexiune WAN IP Dinamic / IP Static / PPPoE/PPTP(Dual Access) / L2TP(Dual Access)
DHCP Server DHCP, Client DHCP, Listă Clienți DHCP, Rezervare adrese IP
Port Forwarding Virtual Server, Port Triggering, UPnP, DMZ
DNS Dinamic DynDns, NO-IP
VPN Pass-Through PPTP, L2TP, IPSec
Control Acces Control Parental, Control Management Local, Host List,
Acces Programat, Managementul Regulilor
Securitate Firewall DoS, Firewall SPI
Filtrare după Adrese IP
Filtrare după Adrese MAC
Filtrare după nume domeniu
Asociere adrese IP/MAC
Protocoale Supports IPv4 and IPv6
Guest Network 1x Guest network 2.4GHz
Certificări CE, FCC, RoHS
Conținut Pachet Router Wireless N 300Mbps 4G LTE
Cablu Ethernet RJ45
Adaptor alimentare
Ghid de Instalre Rapidă
Adaptor pentru Micro SIM
Adaptor pentru Nano SIM
Cerințe de sistem Microsoft Windows 98SE, NT, 2000, XP, Vista™, Windows 7, 8, 8.1, 10
MAC OS, NetWare, UNIX sau Linux

Internet Explorer 11, Firefox 12.0, Chrome 20.0, Safari 4.0 sau browser Java
Card SIM.
SIM Card
Mediu Operating Temperature: 0℃~40℃ (32℉ ~104℉)
Storage Temperature: -40℃~70℃ (-40℉ ~158℉)
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept