Curs valutar


1 EURO = 4.7352 RON  
1 USD = 4.2979 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte


 » Routere wireless

Router Wireless N 300Mbps ,W1

Router Wireless N 300Mbps ,W1

Netis - W1- Netis

Routerul Netis W1 ofera o viteza mare de 300Mbps pentru a va conecta PC-urile,smartphone-urile,camerele wireless si alte dispozitive Wi-Fi.Insotit de 2 antene de 5dBI,asigura o acoperire wireless mai buna.

Alte imagini:
Router Wireless N 300Mbps ,W1
Pret fara TVA:
43.79 RON

Pret cu TVA :
52,11 RON

Disponibilitate :

  • Incredible wireless high speed up to 300Mbps, great for faster downloading, Internet calling and HD video streaming
  • MIMO high gain 5dBi antennas providing maximum range and stable connections
  • Dual operation modes- Router, Bridge (pure access point)
  • Various WAN connection types in AP Router mode- DHCP, Static IP, PPPoE, L2TP, PPTP, Dual Access, WISP
  • Multiple wireless modes- AP, Repeater, AP+WDS, WDS, Client
  • Multi-SSID providing up to 3 additional separate networks for guests and friends
  • Easy wireless security setup at a push of the WPS button
  • Intelligent bandwidth control to manage the bandwidth usage for each computer reasonably
  • Internet Access Control- IP filtering, MAC Filtering, Domain Filtering based on time
  • Quick setup, with built-in multilingual management page


Standards IEEE 802.11b, IEEE 802.11g, IEEE 802.11n
Signal Rate Up to 300Mbps
Frequency Range 2.4-2.4835GHz
Transmit Power 20dBm(MAX)
Data Transfer Rate 802.11n:
40MHz  (300Mbps, 270Mbps, 240Mbps, 180Mbps, 120Mbps, 90Mbps, 60Mbps, 30Mbps)
20MHz  (144Mbps, 130Mbps, 115Mbps, 86Mbps, 57Mbps, 43Mbps, 28Mbps, 14Mbps) (Auto-Sense)
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
(11Mbps, 9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)
Wireless Mode AP, Repeater, AP+WDS, WDS, Client, Multi-SSID
Wireless Security 64/128-bit WEP,
SSID Broadcast Enable/Disable
Wireless MAC Filtering
Standards IEEE 802.3 10Base-T, IEEE 802.3u 100Base-TX
Interface 1 * 10/100Mbps Auto MDI/MDIX RJ45 WAN port
2 * 10/100Mbps Auto MDI/MDIX RJ45 LAN port
Button WPS, Default
Antenna 2* 5dBi Fixed Antenna
Power Supply DC 9V/500mA (Output)
WAN Type DHCP, Static IP, PPPoE, L2TP, PPTP, Dual Access, WISP
Port Forwarding Virtual Servers, Port Triggering, UPnP, DMZ, FTP Private Port
QoS WMM, Bandwidth Control
Access Control IP/MAC/Domain Filtering
VPN Pass-through PPTP, L2TP, IPSec
Others IPTV, Dynamic DNS, Static Routing, WOL, Backup & Restore, Firmware Upgrade
Certification FCC, CE
Environment Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
Package 1* W1
1* 9V/500mA Power Adapter
1* Quick Installation Guide (Multilingual)
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept