Curs valutar


1 EURO = 4.8398 RON  
1 USD = 4.3112 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpgigabitz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerplugprizaraspberry piaudiovideocable4 contactrcajackamikoac routerunifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin


 » Routere wireless

Router Wireless N 150Mbps TP-Link TL-WR720N

Router Wireless N 150Mbps

TP-Link - TL-WR720N

Router wireless N, 150Mbps, suporta pana la 4 SSID-uri retele wireless multiple cu SSID si parole diferite, control trafic pe baza de IP, buton WPS.

Pretul este disponibil pina la lichidarea stocului.

Alte imagini:
Router Wireless N 150Mbps TP-Link TL-WR720NRouter Wireless N 150Mbps TP-Link TL-WR720NRouter Wireless N 150Mbps TP-Link TL-WR720NRouter Wireless N 150Mbps TP-Link TL-WR720N
Router Wireless N 150Mbps TP-Link TL-WR720N

Pret vechi fara TVA :
55,00 RON

Pret nou fara TVA :
37,13 RON

Pret nou cu TVA :
44,19 RON

Disponibilitate :

TP-Link TL-WR720N - 150Mbps Wireless N Router
  • 150Mbps wireless transmission rate ideal for Internet surfing, e-mail and online chat
  • Up to 4 SSIDs support multiple wireless networks with different SSIDs and passwords
  • Easy wireless security encryption at a push of WPS button
  • IP based bandwidth control allows administrators to determine how much bandwidth is allotted to each PC

What This Product Does

The TL-WR720N is a simple and secure way to share your high-speed Internet connection at Wireless-N speeds for surfing the Internet, email or online chat. The wireless N Router is 802.11b & g compatible and gives users 802.11n performance up to 150Mbps at a remarkably affordable price. Bordering on 11n and surpassing 11g speed enables bandwidth-intensive applications such as video streaming. Users can enjoy a high quality experience when video streaming, using VoIP, or gaming online wirelessly, not previously practical with 11g devices.

Exceptional Wireless Performance at an Affordable Price

TP-LINK’s TL-WR720N is a high speed solution that is compatible with IEEE 802.11b/g/n. Based on 802.11n technology, TL-WR720N gives users wireless performance at up to 150Mbps, 9X the speed and 4x the range of traditional 11g products. Enjoy N Power at a G Price!

Multi-SSID Networking - Simple and Secure Wireless Sharing

TL-WR720N supports up to 4 SSIDs. It’s uniquely designed for users to set up additional wireless networks with additional SSIDs and Passwords for guests or friends. This ensures users are safe and there are no performance conflicts with different networks.

CCA Technology - Stable Wireless Signals

Clear Channel Assessment (CCA) automatically avoids channel conflicts using its clear channel selection feature and fully realizes the advantages of channel binding, greatly enhancing wireless performance.

IP QoS -- Manage your Bandwidth

Within the wireless network, indiscriminate Internet surfing and bandwidth-guzzling downloads by internal users often leave homes or small offices with insufficient bandwidth. TL-WR720N supports an IP QoS function, allowing optimum utilization of bandwidth and offering bandwidth control over congestion, preventing bandwidth abuse. In this way, users of a small network receive committed and specific bandwidth, preventing non-critical applications from degrading network performance.

Easy to Use

With the TL-WR720N even novice users can setup their networks. The device comes with a CD featuring an Easy Setup Assistant that leads users through the setup process step-by-step, and even helps with wireless network settings and security configurations.                      

  • Wireless speed up to 150Mbps
  • Easy wireless security encryption at a push of the WPS button
  • Supports Multiple SSIDs to separate different users within the same wireless network
  • WDS Wireless Bridge provides seamless bridging to expand the wireless network
  • IP based Bandwidth Control allows administrators to determine how much bandwidth is allotted to each PC
  • Live Parental Controls allow parents or administrators to establish restricted access policies for children or staff
Hardware Features
2 10/100Mbps LAN Ports
1 10/100Mbps WAN Port
External Power Supply 9VDC / 0.6A
Dimensions (W X D X H) 158 x 122 x 32 mm
Antenna Internal
Wireless Features
Wireless Standards
IEEE 802.11b, IEEE 802.11g, IEEE 802.11n
Signal Rate
Up to 150Mbps
EIRP  <20dBm
Reception Sensitivity 130M: -68dBm@10% PER
108M: -68dBm@10% PER
54M: -68dBm@10% PER
11M: -85dBm@8% PER
6M: -88dBm@10% PER
1M: -90dBm@8% PER
Wireless Functions Enable/Disable Wireless Radio, WDS Bridge, WMM, Wireless Statistics
Wireless Security 64/128/152-bit WEP / WPA / WPA2,WPA-PSK / WPA2-PSK
Software Features
WAN Type
Dynamic IP/Static IP/PPPoE/ PPTP/L2TP/BigPond
Port Setting
Server, Client, DHCP Client List, Address Reservation
Quality of Service
WMM, Bandwidth Control
Port Forwarding Virtual Server, Port Triggering, UPnP, DMZ
Dynamic DNS DynDns, Comexe, NO-IP
VPN Pass-Through PPTP, L2TP, IPSec (ESP Head)
Access Control Parental Control, Local Management Control, Host List, Access Schedule, Rule Management
Firewall Security DoS, SPI Firewall
IP Address Filter/MAC Address Filter/Domain Filter
IP and MAC Address Binding
Management Access Control
Local Management
Remote Management
Certification CE, FCC, RoHS
Package Contents TL-WR720N
Power Supply Unit
Resource CD
RJ-45 Ethernet Cable
Quick Installation Guide
System Requirements Microsoft® Windows® 2000, XP, Vista™ or Windows 7, MAC® OS, NetWare®, UNIX® or Linux.
Environment Operating Temperature: 0°C~40°C
Storage Temperature: -40°C~70°C
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~95% non-condensing
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept