Curs valutar


1 EURO = 4.8421 RON  
1 USD = 4.3983 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpgigabitz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerplugprizaraspberry piaudiovideocable4 contactrcajackamikoac routerunifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin


 » Routere wireless


Router Wireless Gigabit AC1200 MU-MIMO

TP-Link - Archer C6

AC1200 Dual-Band Wi-Fi Gigabit Router, 802.11ac/a/b/g/n, 867Mbps at 5GHz + 300Mbps at 2.4GHz, 5 Gigabit Ports, 4 fixed antennas, Wireless On/Off, WPS, IPv6, IPTV, VPN Server, Multi-EWAN, Multi-SSID, MU-MIMO

Alte imagini:
Pret fara TVA:
172.00 RON

Pret cu TVA :
204,68 RON

pret per bucata
Disponibilitate :
In stoc

AC1200 Router Wireless Dual Band GigabitArcher C6

  • Suportă standardul 802.11ac
  • Conexiuni simultane de 2,4 GHz (300 Mbps) și 5 GHz (867 Mbps) pentru o bandă disponibilă totală de 1200 Mbps
  • 4 antene externe și o antenă internă asigură conexiuni wireless stabile și o acoperire optimă
  • Gestionare la îndemână a rețelei cu TP-Link Tether
  • MU-MIMO este de 2x mai eficient în comunicarea cu până la 2 dispozitive simultan
  • Suportă modul de operare Access Point 


5 Antene de înaltă performanță 
Acoperire Wi-Fi perfectă pentru casa ta

Cu un chipset puternic, Archer C6 dispune și de 4 antene externe și o antenă internă care trimit semnale Wi-Fi în fiecare colț al casei tale, astfel rămâi conectat și te poți bucura de Wi-Fi rapid în toată casa, eliminând zonele fără semnal Wi-Fi.

Crește viteza, throughput-ul, capacitatea

MU-MIMO permite routerului Archer C6 să servească simultan mai multe dispozitive, astfel toate dispozitivele își obțin datele mai rapid, iar Wi-Fi-ul este utilizat mai eficient.

Cerințe sistem Microsoft Windows 10/8.1/8/7/Vista/XP/2000/NT/98SE, MAC OS, NetWare, UNIX or Linux
Internet Explorer 11, Firefox 12.0, Chrome 20.0, Safari 4.0, or other Java-enabled browser
Cable or DSL Modem
Subscription with an internet service provider (for internet access)
Temperatură de operare 0℃~40℃ (32℉ ~104℉)
Temperatură de stocare -40℃~70℃ (-40℉ ~158℉)
Umiditate de operare 10%~90% non-condensing
Umiditate de stocare 5%~90% non-condensing
Conținut pachet Wireless Router Archer C6
Power Adapter
RJ45 Ethernet Cable
Quick Installation Guide
Porturi 4*10/100/1000Mbps LAN Ports, 1*10/100/1000Mbps WAN Port
Butoane Reset Button, Power On/Off Button, WPS/Wi-Fi On/Off Button
Alimentator 12V/1A
Dimensiuni (L x l x H) 9.1 × 5.7 × 1.4 in (230 × 144 × 35 mm)
Antenă 4 Fixed Omni Directional Antennas
Standarde Wireless IEEE 802.11ac/n/a 5GHz, IEEE 802.11b/g/n 2.4GHz
Frecvență 2.4GHz and 5GHz
Rată de Semnal 5GHz: Up to 867Mbps
2.4GHz: Up to 300Mbps
Sensibilitate Receptor 5GHz:
11a 6Mbps:-93dBm;11a 54Mbps:-78dBm;
11ac HT20 mcs8:69dBm;11ac HT40 mcs9:-65dBm;
11ac HT80 mcs9:-62dBm;
11g 54Mbps:-78dBm;
11n HT20 mcs7:-74dBm;
11n HT40 mcs7:-71dbm;
Putere de Transmisie CE EIRP: <20dBm(2.4GHz); <23dBm(5GHz)
Funcții Wireless Enable/Disable Wireless Radio, WDS Bridge, WMM,
Wireless Statistics
Securitate Wireless 64/128-bit WEP,WPA / WPA2,WPA-PSK/ WPA2-PSK encryption
Tip WAN Dynamic IP, Static IP, PPPoE, PPTP (Dual Access), L2TP (Dual
Access), BigPond
Management Access Control, Local Management, Remote Management
DHCP Server, DHCP Client List, Address Reservation
Port Forwarding Virtual Server, Port Triggering, UPnP, DMZ
DNS Dinamic DynDns, NO-IP
Control Acces Parental Controls, Local Management Control, Host List, White List, Black List
Securitate Firewall DoS, SPI Firewall, IP and MAC Address Binding
Protocoale IPv4, IPv6
Guest Network 2.4GHz guest network, 5GHz guest network
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept