Curs valutar

18-Jul-2019

1 EURO = 4.7345 RON  
1 USD = 4.2201 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic

ANPC

 » Routere wireless



front

Router Wireless Dual Band AC750

TP-Link - Archer C20

AC750 Dual-Band Wi-Fi Router, 802.11ac/a/b/g/n, 433Mbps at 5GHz + 300Mbps at 2.4GHz, 5 10/100M Ports, 3 fixed antennas, Wireless On/Off, WPS , IPv6 Ready, Tether App

Alte imagini:
back
Pret fara TVA:
105.00 RON

Pret cu TVA :
124,95 RON

Disponibilitate :
Sunati

  • AC750 Router Wireless Dual BandArcher C20
    • Suportă standardul 802.11ac - următoarea generație Wi-Fi 
    • Conexiuni simultane în frecvența de 2.4GHz (300Mbps) și în frecvența de 5GHz (433Mbps) pentru un total de bandă disponibilă de 733Mbps
    • 3 antene externe, care oferă acoperire wireless omnidirecțională foarte bună și acoperire wireless superioară

 

CARACTERISTICI HARDWARE
Interfață 4 Porturi LAN 10/100Mbps
1 Port WAN 10/100Mbps
Butoane Buton Reset
Buton WPS/Wireless Pornit/Oprit
Buton Alimentare Pornit/Oprit
Antenă 2 Antene fixe externe 2GHz
1 Antena fixă externa 5GHz
Alimentare Externă 9V/0.6A
Dimensiuni (L x l x H) 230 x 144 x 35mm
CARACTERISTICI WIRELESS
Standarde Wireless IEEE 802.11ac/n/a 5GHz
IEEE 802.11b/g/n 2.4GHz
Frecvență 2.4GHz și 5GHz
Rată de Semnal 5GHz: până la 433Mbps
2.4GHz: până la 300Mbps
Sensibilitate Receptor 5GHz:
11a 54M: -76dBm; 11ac VHT20 MCS8: -71dBm;
11ac VHT40 MCS9: -66dBm; 11ac VHT80 MCS9:
-62dBm
2.4GHz:
11g 54M: -76dBm11n; HT20 MCS7: -73dBm;
11n HT40 MCS7: -71dBm
Funcții Wireless Activare / Dezactivare radio wireless, WDS Bridge, WMM, Statistică Wireless
Securitate Wireless Criptare 64/128-bit WEP, WPA/WPA2, WPA-PSK/WPA2-PSK
Putere de Emisie CE:
<20dBm(2.4GHz)
<23dBm(5GHz)
CARACTERISTICI SOFTWARE
Calitatea Serviciului WMM, Bandwidth Control
Management Controlul accesului
Management local
Management de la distanță
Port Forwarding Virtual Server, Port Triggering, UPnP, DMZ
DNS Dinamic DynDns, Comexe, NO-IP
VPN Pass-Through PPTP, L2TP, IPSec
Control Acces Control parental,
Controlul Managementului local, Listă de utilizatori, Program de acces, Managementul regulilor
Securitate Firewall DoS, SPI Firewall
Filtrare adrese IP / Filtrare adrese MAC / Domain Filter
IP and MAC Address Binding
Protocoale Suport IPv4 și IPv6
Guest Network 2.4GHz guest network × 1
5GHz guest network × 1
ALTELE
Certificări CE, RoHS
Conținut Pachet Router AC750 Archer C20 Dual Band Wireless
Sursă de alimentare externă
Cablu Ethernet
Ghid de instalare rapidă
Dimensiuni Cutie (L x l x H) 357x223x68mm
Cerințe de sistem Windows 10/8.1/8/7/Vista/XP, Mac OS sau Linux
Internet Explorer, Firefox, Chrome, Safari sau alt browser compatibil Java
Mediu Temperatură de funcționare: 0℃~40℃
Temperatură de depozitare: -40℃~70℃
Umiditatea mediului în care funcționează: 10%~90% fără condens
Umiditatea mediului în care este depozitat: 5%~90% fără condens

 

 

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept