Curs valutar


1 EURO = 4.7204 RON  
1 USD = 4.2231 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvc


 » Routere wireless

Archer C50

Router Wireless Dual Band AC1200

TP-Link - Archer C50

AC1200 Dual-Band Wi-Fi Router, 802.11ac/a/b/g/n, 867Mbps at 5GHz + 300Mbps at 2.4GHz, 5 10/100M Ports, 4 fixed antennas, Wireless On/Off, WPS, IPv6 Ready, Tether App

Alte imagini:
Archer C50
Pret fara TVA:
125.00 RON

Pret cu TVA :
148,75 RON

Disponibilitate :

  • AC1200 Router Wireless Dual BandArcher C50

    • Suportă standardul 802.11ac - următoarea generație Wi-Fi
    • Conexiuni simultane în frecvența de 2.4GHz (300Mbps) și în frecvența de 5GHz (867Mbps) pentru un total de bandă disponibilă de 1.2Gbps
    • 4 antene asigură conexiuni wireless stabile și o acoperire optimă 
    • Management ușor al rețelei cu ajutorul aplicației TP-Link Tether


Interfața 4 porturi LAN 10/100Mbps
1 port WAN 10/100Mbps
Butoane Buton Reset
Buton WPS/Wireless Pornit/Oprit
Buton Pornit/Oprit
Alimentare Externa 9VDC / 0.85A
Dimensiuni (L x l x H) 229.87 x 144.19 x 36.85 mm
Tip antena 4 Antene Externe
Standarde Wireless IEEE 802.11n/g/b 2.4GHz
IEEE 802.11ac/n/a 5GHz
Frecvența 2.4GHz și 5GHz
Rata de Semnal 2.4GHz: Pâna la 300Mbps
5GHz: Pâna la 867Mbps
Sensibilitate Receptor 5GHz:
11a 54M: -76dBm
11ac VHT20 MCS8: -70dBm
11ac VHT40 MCS9: -65.5dBm
11ac VHT80 MCS9: -61.5dBm
11g 54M: -76dBm
11n HT20 MCS7: -74dBm
11n HT40 MCS7: -71d
Putere de Transmisie CE:
<20dBm (2.4GHz)
<23dBm (5GHz)
Funcții Wireless Activare/Dezactivare emisie wireless, WDS Bridge, WMM, Statistici wireless
Securitate Wireless 64/128-bit WEP, WPA / WPA2, WPA-PSK/ WPA2-PSK encryption
Calitatea Serviciului WMM, Controlul lațimii de banda
Tip WAN IP Dinamic/IP Static/PPPoE/BigPond/L2TP(Dual Access)/PPTP(Dual Access)
Management Access Control
Control din rețea
Control la distanța
DHCP Server DHCP, Client, Lista clienți DHCP, Rezervare adrese IP
Port Forwarding Virtual Server, Port Triggering, UPnP, DMZ
DNS Dinamic DynDns, Comexe, NO-IP
VPN Pass-Through PPTP, L2TP, IPSec
Control Acces Control Parental, Management Local, Host List, Acces
Programat, Managementul Regulilor
Securitate Firewall DoS, SPI Firewall
IP Address Filter/MAC Address Filter/Domain Filter
IP and MAC Address Binding
Protocoale Suport IPv4 și IPv6
Guest Network 2.4GHz guest network × 1
5GHz guest network × 1
Certificari CE, FCC, RoHS
Conținut Pachet Router Dual Band Wireless AC1200 Archer C50
Adaptor alimentare
Cablu Ethernet
Ghid de instalare rapida
Cerințe de sistem Microsoft Windows 98SE, NT, 2000, XP, Vista™, 7, 8/8.1, 10
MAC OS, NetWare, UNIX sau Linux
Mediu Temperatura de funcționare: 0℃~40℃
Temperatura de depozitare: -40℃~70℃
Umiditatea mediului în care funcționeaza: 10%~90% fara condensare
Umiditatea mediului în care este depozitat: 5%~90% fara condensare



Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept