Curs valutar


1 EURO = 4.8582 RON  
1 USD = 4.0972 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoegigabitcablu utpz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfac routergatewayplugprizawirelessterouter wireless routerraspberry piaudiovideocable4 contactrcajackamikounifiraspberry pi 2 model benergytkb4k3kmxsfpddmmountableantene 24ghz802.3atmeterraftsolo10gplc2plc4door phone720pcomutatormicro switchperetemountwdm1000mswitch poeinjectormobilamesh3000ventmanagementplc8rtl8370-grconectorconectorirapidelectricdateelectriciraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfanextender3g4grg6plc16router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4kseoutdoor650ups120060001000010kvausbepscentrala5ghzfemalegigaethernetmiraac1200om1svcstackingcoaxvflsmbgftp5plc8-absbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2cablu ftpab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascablutvcamewradvr4ch150mmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gaming20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetallitatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin bgftp6bgftp6pebgutp5bgutp6bgutp3bgutp5pebgftp5pebgutp6lszhbgutp6pebgutp5lszhbgsf/utp5lsnhbgftp5lszhbgftp6lszhbgf/ftp6abgf/ftp6apebgftp6alszhtooless>qrg11>xtrg11cu-mxtrg6uxtrg6mxtrg11mxtprg11cupextrg11pvcxtrg6m/txtrg6/txtrg11m/txtrg6u100xtrg6lszhxtrg11/tbgrg6ubgrg6/tbgrg6mbgrg6m/tbgrg11mbgrg11m/tbgrg6lszhbgrg6/tlszh802.3btplc4-absplc16apcbgkutp5bgkutp5pbgkutp5pem>bgkftp5>bgkftp5pem


 » Routere wireless


Router Wireless AC1200 Gigabit V4

TP-Link - Archer C5 V4

AC1200 Dual-Band Wi-Fi Gigabit Router, 802.11ac/a/b/g/n, 867Mbps at 5GHz + 300Mbps at 2.4GHz, 5 Gigabit Ports, 1 USB 2.0, 4 fixed antennas, Wireless On/Off, WPS, IPv6, IPTV, VPN Server, Multi-EWAN, Multi-SSID, TR-069, TR-098 (Remote Management for ISP), Agile Config (Set up Default Configuration for ISP)

Alte imagini:
Acest produs nu mai este disponibil!
Disponibilitate :

AC1200 Router Wireless Dual Band GigabitArcher C5 V4

  • Wi-Fi Dual Band foarte rapid, cu performanțe wireless de până la 1.2Gbps, 300Mbps pe banda de 2.4GHz și 867Mbps pe banda de 5GHz
  • Porturi Gigabit, 1 port WAN 1000Mbps și 4 porturi LAN 1000Mbps pentru viteze de transfer ultra-rapide
  • 4 antene externe care asigură conexiuni wireless stabile și o acoperire optimă
  • Port USB 2.0 pentru Internet backup folosind un modem USB 3G/4G dar și pentru partajarea ușoară a documentelor și fișierelor media
  • Administrare ușoară la distanță, protocolul TR-069 permite unui operator să configureze și să gestioneze de la distanță dispozitivele utilizatorilor finali


Interfață 4 porturi LAN 10/100/1000Mbps 
1 port WAN 10/100/1000Mbps
Sursă Alimentare 12VDC/1.0A
Dimensiuni (L x l x H) 230.0 * 144.0 * 37.0 mm
Tip antenă 4 Antene nedetașabile
Standarde Wireless IEEE 802.11n/g/b 2.4GHz 
IEEE 802.11ac/n/a 5GHz
Frecvență 2.4GHz și 5GHz
Rată de Semnal 2.4GHz: Până la 300Mbps 
5GHz: Până la 867Mbps
Sensibilitate Receptor 5GHz: 
11a 54M: -73dBm; 
11ac VHT20 MCS8: -66dBm;
11ac VHT40 MCS9: -61dBm; 
11ac VHT80 MCS9: -58dBm.
11g 54M: -75dBm;
11n HT20 MCS7: -73dBm;
11n HT40 MCS7: -70dBm
Putere de Transmisie CE: <20dBm(2.4GHz), <23dBm(5GHz)
FCC: <30dBm
Funcții Wireless Activare/dezactivare emisie wireless, WDS Bridge, WMM, Statistici wireless
Securitate Wireless Autentificare wireless WPA/WPA2 și WPA-PSK/WPA2-PSK, împreună cu criptare TKIP/AES 
64/128-bit criptare de securitate WEP și wireless LAN ACL (Access Control List).
Calitatea Serviciului WMM, Bandwidth Control
Tip WAN Dynamic IP, Static IP, PPPoE
Management Access Control, Local Management, Remote Management
DHCP Server, Client, DHCP Client List,
Address Reservation
Port Forwarding Virtual Server, Port Triggering, UPnP, DMZ
DNS Dinamic DynDns, NO-IP
Control Acces Parental Control, Local Management Control, Host list, Access Schedule, Rule Management
Protocoale IPv4 și IPv6
Conținut Pachet AC1200 Wireless Dual Band Gigabit Router
Adaptor alimentare
Ghid instalare rapidă
Cablu RJ45
Cerințe de sistem Microsoft Windows 10/8.1/8/7/Vista/XP/2000/NT/98SE, MAC OS, NetWare, UNIX sau Linux
Mediu Temperatură de funcționare: 0℃~40℃ (32℉~104℉) 
Temperatură de depozitare: -40℃~70℃ (-40 ℉~158℉) 
Umiditatea mediului în care funcționează: 10%~90% fără condensare
Umiditatea mediului în care este depozitat: 5%~90% fără condensare
Certificări CE, FCC, RoHS
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept