Curs valutar


1 EURO = 4.7790 RON  
1 USD = 4.3101 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:


 » Routere wireless

Archer C2

Router Wireless AC 750Mbps

TP-Link - Archer C2 (End of Life)

Standard 802.11ac urmatoarea generatie Wi-Fi
Conexiune simultana în 2.4GHz 450Mbps si 5GHz 433Mbps pentru 733Mbps din totalul latimi de banda disponibile.

Acest produs nu mai este disponibil!
Disponibilitate :

Router Gigabit Wireless Dual Band AC900, Archer C2

  • Suporta standardul 802.11ac - urmatoarea generație Wi-Fi
  • Conexiuni simultane în frecvența de 2.4GHz (450Mbps) și în frecvența de 5GHz (433Mbps) pentru un total de banda disponibila de 883Mbps
  • 3 antene externe, care ofera acoperire wireless omnidirecționala foarte buna și fiabilitate maxima
  • Porturi gigabit care asigura viteze de transfer ultrarapide


Interfața 4 Porturi LAN 10/100/1000Mbps
1 Port WAN 10/100/1000Mbps
Butoane Buton WPS/Reset
Buton Wireless Pornit/Oprit
Buton Alimentare Pornit/Oprit
Antena 2 × 2.4GHz Antennas
1 × 5GHz & 2.4GHz Dual Band Antenna
Alimentare Externa 9V/0.85A
Dimensiuni (L x l x H) 230 x 144 x 35mm
Tip antena 2 × 2.4GHz Antennas
1 × 5GHz+2.4GHz Dual Band Antenna
Standarde Wireless IEEE 802.11ac/n/a 5GHz
IEEE 802.11b/g/n 2.4GHz
Frecvența 2.4GHz și 5GHz
Rata de Semnal 5GHz: Pâna la 433Mbps

2.4GHz: Pâna la 450Mbps
Sensibilitate Receptor 5GHz: 
11a 54M: -76dBm; 11ac VHT20 MCS8: -70dBm;
11ac VHT40 MCS9: -65.5dBm; 11ac VHT80 MCS9:
11g 54M: -76dBm11n; HT20 MCS7: -74dBm;
11n HT40 MCS7: -71dBm
Putere de Transmisie CE:
Funcții Wireless Activare / Dezactivare radio wireless, WDS Bridge, WMM, Statistica Wireless
Securitate Wireless Criptare 64/128-bit WEP, WPA/WPA2, WPA-PSK/WPA2-PSK
Calitatea Serviciului WMM, Bandwidth Control
Tip WAN Dynamic IP/Static IP/PPPoE/
PPTP(Dual Access)/L2TP(Dual Access)/BigPond
Management Controlul Accesului
Management Local
Management de la Distanța
DHCP Server, Client, Lista Clienți DHCP,
Rezervare de adrese
Port Forwarding Virtual Server, Port Triggering, UPnP, DMZ
DNS Dinamic DynDns, Comexe, NO-IP
VPN Pass-Through PPTP, L2TP, IPSec
Control Acces Control Parental,
Controlul Managementului local, Lista de Utilizatori, Program de Acces, Managementul Regulilor
Securitate Firewall DoS, SPI Firewall, IP Address Filter/Domain Filter, IP and MAC Address Binding
Protocoale Suport pentru IPv4 și IPv6
Guest Network 2.4GHz guest network × 1
5GHz guest network × 1
Certificari CE, FCC, RoHS
Conținut Pachet Router Archer C2 Dual Band Wireless Gigabit

Sursa de alimentare externa

Cablu Ethernet

Ghid de instalare rapida
Cerințe de sistem Windows 10/8.1/8/7/Vista/XP, Mac OS sau sistem de operare Linux
Mediu Temperatura de Funcționare: 0℃~40℃ (32℉~104℉)
Temperatura de Depozitare: -40℃~70℃ (-40 ℉~158℉)
Umiditatea mediului în care funcționeaza: 10%~90% fara condensare
Umiditatea mediului în care este depozitat: 5%~90% fara condensare
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept