Curs valutar


1 EURO = 4.7345 RON  
1 USD = 4.2201 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic


 » Routere wireless

Archer C9

Router Wireless AC 1900Mbps

TP-Link - Archer C9

AC1900 Dual-Band Wi-Fi Router, Broadcom 1GHz dual-core CPU, 802.11ac/a/b/g/n, 1300Mbps at 5GHz + 600Mbps at 2.4GHz, 5 Gigabit Ports, 1 USB 3.0 +1 USB 2.0 , 3 detachable antennas , Beamforming, IPTV, Cloud support, Wireless On/Off ,WPS, IPv6 Ready,Tether App

Pret fara TVA:
450.00 RON

Pret cu TVA :
535,50 RON

Disponibilitate :

AC1900 Router Gigabit Wireless Dual BandArcher C9

  • Suportă standardul 802.11ac 
  • Conexiuni simultane în 2.4GHz (600Mbps) și 5GHz (1300Mbps) pentru o lățime de bandă disponibilă de 1.9Gbps
  • Cele 3 antene detașabile dual band asigură o acoperire wireless omnidirectională și fiabilitate maximă
  • Tehnologia Beamforming oferă o conexiune wireless extrem de eficientă
  • Procesorul dual-core 1GHz asigură continuitate când procesează multiple conexiuni wireless sau prin cablu
  • Porturile USB 3.0 + USB 2.0 - asigură partajarea unei imprimante în rețea sau partajarea de fișiere și filme cu celelalte dispozitive din rețea sau de la distanță printr-un server FTP


Interfața 4 porturi 10/100/1000Mbps LAN,
1 port 10/100/1000Mbps WAN
1 port USB 3.0 Port + 1 port USB 2.0
Butoane Buton WPS/Reset,
Buton Wireless Pornit/Oprit,
Buton Pornire Pornit/Oprit
Antena 3 antene detașabile dual band
Alimentare Externa 12V/3.3A
Dimensiuni (L x l x H) 221 X 86 X 168.5mm
Standarde Wireless IEEE 802.11ac/n/a 5GHz
IEEE 802.11b/g/n 2.4GHz
Frecvența 2.4GHz și 5GHz
Rata de Semnal 5GHz: pâna la 1300Mbps
2.4GHz: pâna la 600Mbps
Sensibilitate Receptor 5GHz:
11a 6Mbps: -94dBm
11a 54Mbps: -76dBm
11ac HT20: -68dBm
11ac HT40: -64dBm
11ac HT80: -60dBm
11g 54M: -77dBm
11n HT20: -73dBm
11n HT40: -71dBm
Putere de Transmisie CE:
Funcții Wireless Wireless Activat/Dezactivat, WDS Bridge, WMM, Statistici Wireless
Securitate Wireless Criptare 64/128-bit WEP, WPA/WPA2, WPA-PSK/WPA-PSK2
Calitatea Serviciului WMM, Controlul lațimi de banda
Tip WAN Dinamic IP/Static IP/PPPoE/
PPTP(Dual Access)/L2TP(Dual Access)/BigPond
Management Access Control
Control din rețea
Control la distanța
DHCP Server, Client, DHCP Client List,
Address Reservation
Port Forwarding Virtual Server, Port Triggering, UPnP, DMZ
DNS Dinamic DynDns, Comexe, NO-IP
VPN Pass-Through PPTP, L2TP, IPSec
Control Acces Control Parental, Local Management Control, Host List, Access Schedule, Rule Management
Securitate Firewall DoS, SPI Firewall
IP Address Filter/MAC Address Filter/Domain Filter
IP and MAC Address Binding
Protocoale Supports IPv4 și IPv6
Partajare USB Suport Samba(Storage)/FTP Server/Media Server/Printer Server
Guest Network 2.4GHz guest network × 1
5GHz guest network × 1
Certificari CE, FCC, RoHS
Conținut Pachet Router Wireless Dual Band Gigabit AC1900
3 antene detașabile
CD resurse
Cablu de rețea
Ghid instalare rapida
Cerințe de sistem Microsoft Windows 98SE, NT, 2000, XP, Vista™ or Windows 7, Windows 8, MAC OS, NetWare, UNIX or Linux
Mediu Temperatura operare : 0℃~40 ℃
Temperatura depozitare: -40℃~70 ℃
Umiditatea in timpul folosiri: 10%~90% non-condensing
Umiditatea in timpul depozitari: 5%~90% non-condensing
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept