Curs valutar


1 EURO = 4.7345 RON  
1 USD = 4.2201 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic


 » Routere wireless

Archer C7

Router Wireless AC 1750Mbps

TP-Link - Archer C7

AC1750 Dual-Band Wi-Fi Router, Qualcomm, 802.11ac/a/b/g/n, 1300Mbps at 5GHz + 450Mbps at 2.4GHz, 5 Gigabit Ports, 1 USB 2.0, 3 antennas, WPS/Wireless On/Off, IPTV, Cloud support, VPN Server, IPv6 Ready,Tether App

Pret fara TVA:
300.00 RON

Pret cu TVA :
357,00 RON

Disponibilitate :

AC1750 Router Wireless Dual Band GigabitArcher C7

  • Suportă standardul 802.11ac - de 3 ori mai rapid decât vitezele N wireless
  • Conexiuni simultane de 2,4 GHz (450 Mbps) și 5 GHz (1300 Mbps) pentru o lățime de bandă disponibilă de 1,75 Gbps
  • Port USB - permite partajarea ușoară a documentelor și fișierelor media cu dispozitivele din rețea sau de la distanță prin intermediul serverului FTP
  • Acces Guest Network - oferă acces Wi-Fi securizat pentru oaspeții care folosesc rețeaua ta de acasă sau de la birou
  • Configurare și gestionare ușoară cu aplicația Tether 


Interfața 4 Porturi LAN 10/100/1000Mbps
1 Port WAN 10/100/1000Mbps
2 Porturi USB 2.0
Butoane Buton WPS/Reset
Buton Wireless Pornit/Oprit
Buton Alimentare Pornit/Oprit
Alimentare Externa 12VDC / 2A
Dimensiuni (L x l x H) 243x160.6x32.5 mm
Tip antena Trei antene detașabile (RP-SMA)
Standarde Wireless IEEE 802.11ac/n/a 5GHz
IEEE 802.11b/g/n 2.4GHz
Frecvența 2.4GHz și 5GHz
Rata de Semnal 5GHz: Pâna la 1300Mbps
2.4GHz: Pâna la 450Mbps
Sensibilitate Receptor 5GHz:
11a 6Mbps-96dBm
11a 54Mbps: -79dBm
11ac HT20: -71dBm
11ac HT40: -66dBm
11ac HT80: -63dBm
11g 54M: -77dBm
11n HT20: -74dBm
11n HT40: -72dBm
Putere de Transmisie CE:
Mod Wireless  
Funcții Wireless Activare / Dezactivare radio wireless, WDS Bridge, WMM, Statistica Wireless
Securitate Wireless Criptare 64/128-bit WEP, WPA/WPA2, WPA-PSK/WPA2-PSK
Calitatea Serviciului WMM, Bandwidth Control
Tip WAN IP Dinamic/IP Static/PPPoE/ PPTP(Dual Access)/L2TP(Dual Access)/BigPond
Management Controlul Accesului
Management Local
Management de la Distanța
DHCP Server DHCP, Client DHCP, Lista clienți DHCP, Rezervare adrese IP
Port Forwarding Virtual Server, Port Triggering, UPnP, DMZ
DNS Dinamic DynDns, Comexe, NO-IP
VPN Pass-Through PPTP, L2TP, IPSec
Control Acces Control parental, Controlul Managementului local, Lista de utilizatori, Program de acces, Managementul regulilor
Securitate Firewall DoS, SPI Firewall
Filtrare adrese IP / Filtrare adrese MAC / Domain Filter
IP și MAC Address Binding
Protocoale Suport pentru IPv4 și IPv6
Partajare USB Suport Samba(Storage)/FTP Server/Media Server/Printer Server
Guest Network Guest network 2.4GHz × 1 Guest network 5GHz × 1
Certificari CE, FCC, RoHS
Conținut Pachet Router Gigabit Dual Band Wireless AC1750 Archer C7 3 Antene detașabile Adaptor alimentare Cablu Ethernet Ghid de instalare rapida
Cerințe de sistem Microsoft Windows 98SE, NT, 2000, XP, Vista™ sau Windows 7, Windows 8, MAC OS, NetWare, UNIX sau Linux
Mediu Temperatura de funcționare: 0℃~40℃ (32℉~104℉) Temperatura de depozitare: -40℃~70℃ (-40 ℉~158℉) Umiditatea mediului în care funcționeaza: 10%~90% fara condensare Umiditatea mediului în care este depozitat: 5%~90% fara condensare
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept