Curs valutar

17-Nov-2019

1 EURO = 4.7667 RON  
1 USD = 4.3224 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavecablu utpstabilizator de tensiuneswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolodoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpower

ANPC

 » Routere wireless



Router Modem ADSL2 Wireless 150Mbps TD-W8950ND

Router Wireless 150Mbps cu Modem ADSL2

TP-Link - TD-W8950ND

Modem Router 150Mbps Wireless Lite N ADSL2+ , Broadcom+Atheros chipset, ADSL/ADSL2/ADSL2+, Annex A, cu spliter ADSL, compatibil cu 802.11n/g/b, 1 antena detasabila

Pret fara TVA:
96.00 RON

Pret cu TVA :
114,24 RON

Disponibilitate :
Sunati

TP-Link TL-W8950ND - 150Mbps Wireless N ADSL2+ Modem Router
  • ADSL modem, NAT router and wireless access point in one device provides one-stop networking solution
  • Exceptional wireless speed up to 150Mbps, Great for on-line gaming, making Internet call or even HD video streaming
  • Easy Setup Assistant provides quick & hassle free installation
  • Wireless security encryption easily at a push of QSS button
  • WDS wireless bridge provides seamless bridging to expand your wireless network
Description

TP-LINK 150Mbps Wireless ADSL2+ Modem Router TD-W8950ND is a high performance modem router that provides a full rate of ADSL2+ standard with the superb reliability and a cost-effective solution for home and small business. It is a 3-in-1 device that combines the function of a high-speed DSL modem, a 4-Port 10/100Mbps NAT router and a wireless Lite N access point. Using the TD-W8950ND, you can easily create a secure and high-speed wireless network and enjoy more kinds of bandwidth consuming applications like HD video streaming wirelessly which can not be accommodated by 11g products, from anywhere in your entire home or even the yard.

One-Stop Solution
As a 3-in-1 device,TD-W8950ND combines the functions of a high speed DSL modem, a 4-Port 10/100Mbps NAT router and a wireless Lite N access point. No need to buy a separate router and wireless access point, the TD-W8950ND is designed to give you a one-stop solution to acquiring and sharing high speed Internet access over a wired/wireless network. TD-W8950ND allows you to completely get rid of cable clutter of multiple devices over the desktop while at the same time helps you save the cost of procurement and the cost of device running.

Access High-Speed Internet
Unlike a dial-up Internet service, a DSL Internet connection is always on so that you do not have to wait to access the web. Supporting the latest ADSL standard, the TD-W8950ND provides higher performance (up to 24Mbps downstream) and longer reach from center office of your Internet Service Provider (ISP). This device also supports TR-069, which automatically updates the firmware and other setting when they become available from your ISP.

Exceptional Wireless Performance
TD-W8950ND is a high speed solution that complies with wireless 802.11b/g, and is compatible with 802.11n standard. Based on Lite N technology and with CCA™ automatically avoiding channel conflicts, TD-W8950ND provide speeds of up to 150Mbps, 9X the speed and 4x the range of traditional 11g products, bordering on conventional 11N and surpassing 11G performance enabling high bandwidth-consuming application

Easy To Use
The device comes with a CD with an Easy Setup Assistant that helps you step by step to complete your Internet connection, wireless network settings and security configurations. This feature allows even novice users to setup the router products without sacrificing any key features, just play the AUTO-RUN CD bundled to have your network set up quickly & hassle-free.

Quick Secure Setup
To get started just push the QSS button on the wireless router, then push the QSS button or enter the routers PIN Code in the wireless client, and it automatically establishes a WPA secure connection. Not only is this faster than normal security setups but more convenient in that you don´t need to remember a password!

Advanced Network Security
TD-W8950ND utilizes SPI(stateful packet inspection) firewall which inspects the contents of incoming packets before they are allowed in, preventing potential attacks from across the Internet. For added convenience, it supports access control based on the time of day, MAC address, IP address, or domain name so parents and network administrators can establish restricted access policies for children or staff.

QoS
Built-in QoS engine provides various QoS policies that help prioritize Internet traffic to enable smooth IPTV streaming and lag-free online gaming. Thus users could experience the benefit of smooth network connection without concern of traffic congestion.

Features
  • High speed DSL modem, NAT router and wireless access point in one device provides one-stop networking solution
  • Wireless speed up to 150Mbps makes it ideal for bandwidth consuming or interruption sensitive applications like online gaming and even the HD video streaming
  • Easy Setup Assistant1 provides quick & hassle free installation
  • WPA/WPA2 encryptions provide your network with active defense against security threats
  • SPI and NAT firewall protects end-user devices from potential attacks across the Internet
  • Easily setup a WPA encryption secured connection at a push of QSS button
  • QoS enables smooth IPTV streaming and lag-free online gaming
  • WDS wireless bridge provides seamless bridging to expand your wireless network
  • Support up to 10 IPSec VPN tunnels simultaneously
  • Auto-reconnect keeps you online indefinitely
  • Backward compatible with 802.11b/g products

1)The Easy Setup Assistant Utility Support Windows 2000/XP/Vista and Windows 7 operating system for present.

Specifications
Software Specification
ADSL Features Full-rate ANSI T1.413 Issue 2
ITU-T G.992.1 (G.dmt)
ITU-T G.994.1 (G.hs)
ITU-T G.992.3 (G.lite.bis)
ITU-T G.992.5
Max 6 kilometers
Data Rates Downstream: Up to 24Mbps
Upstream: Up to 1.5Mbps
ATM Features UNI 3.1,ATM Adaptation Layer Type 5-AAL5
Multiprotocol encapsulation over ATM (RFC 1483)
UBR, CBR, VBR-rt, VBR-nrt
Supports 8PVCs
PPP Features PPP over ATM (RFC 2364)
PPP over Ethernet (RFC 2516)
Switching IGMP multicast
IEEE 802.1d transparent learning bridging
Routing Features Classical IP and ARP over ATM (RFC 1577/2225), MER
Static Routing, IP, TCP, UDP, ARP
NAT, NAPT, DNS, DDNS, DHCP Server
UPnP, Virtual Server, DMZ, Port Trigger
Wireless Features Complies with IEEE802.11n 1, IEEE 802.11g, IEEE802.11b
11n: Up to 150Mbps(dynamic)
Security: WEP 64bit/128bit , WPA-PSK/WPA2-PSK , WPA/WPA2
Provides 64/128bit WEP encryption security and wireless LAN ACL (Access Control List)
Max wireless transmit power: 17dbm
Antenna gain: 3dbi
Frequency Range:2.4~2.4835GHz
Security NAT and SPI Firewall
IP Filtering
MAC filtering
Parental control
IPSec VPN Support up to 10 IPSec VPN tunnels
VPN Pass Through IPSec/PPTP Pass-through
QoS IP Type of service(ToS)
Device Management HTTP
Administration and operation software (firmware) upgradable locally by web(HTTP)
CWMP(TR-069)
Hardware Specification
Ports 4 10/100M LAN Ports(RJ45)
1 Line Port(RJ11)
LED Indicators Power, Internet, ADSL, WLAN, LAN1~4,QSS
Dimensions 174*120*28.8 mm
Operating Temperature 0oC~40oC
Storage temperature -40oC~70oC
Relative Humidity 10% ~ 90%, Non Condensing
Storage Humidity 5%~90% Non-Condensing
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept