Curs valutar

09-Aug-2020

1 EURO = 4.8375 RON  
1 USD = 4.0949 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoegigabitcablu utpz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewayplugprizawirelessterouter wireless routerac routerraspberry piaudiovideocable4 contactrcajackamikounifiraspberry pi 2 model benergytkb4k3kmxsfpddmmountableantene 24ghz802.3atmeterraftsolo10gdoor phone720pcomutatormicro switchperetemountwdm1000mswitch poeinjectormobilamesh3000ventrtl8370-grconectorconectorirapidelectricdateelectriciraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfanextender3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4kseoutdoor650ups120060001000010kvausbepscentrala5ghzfemalegigaethernetmiraac1200om1svcstackingcoaxvflsmbgftp5baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2cablu ftpab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascablutvcamewradvr4ch150mmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gaming20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetallitatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin bgftp6bgftp6pebgutp5bgutp6bgutp3bgutp5pebgftp5pebgutp6lszhbgutp6pebgutp5lszhbgsf/utp5lsnhbgftp5lszhbgftp6lszhbgf/ftp6abgf/ftp6apebgftp6alszhtooless>qrg11>xtrg11cu-mxtrg6uxtrg6mxtrg11mxtprg11cupextrg11pvcxtrg6m/txtrg6/txtrg11m/txtrg6u100xtrg6lszhxtrg11/tbgrg6ubgrg6/tbgrg6mbgrg6m/tbgrg11mbgrg11m/tbgrg6lszhbgrg6/tlszh802.3bt

ANPC

 » Routere si modemuri ADSL



Router TP-Link TL-R460

Router SOHO/birou pe cablu, fara radiatie WiFi, 4 porturi LAN *10/100

TP-Link - TL-R460

1 port WAN  + 4 porturi LAN, Router de cablu/DSL  pentru casa si birou, formare la cerere, Firewall avansat, control parental, DDNS, UPnP, 802.1X, DHCP, gazduire DMZ , trecere VPN
permite doar conectarea pe cele 4 porturi LAN, fara conexiune wireless si fara radiatii nocive






Pret vechi fara TVA :
60,00 RON


Pret nou fara TVA :
35,54 RON

Pret nou cu TVA :
42,29 RON

Disponibilitate :
Sunati

TP-Link TL-R460 - Cable/DSL Router for Home and Small Office
 • 4 10/100Mbps Auto-Negotiation LAN ports, supporting Auto-MDI/MDIX,1 10/100Mbps Auto-Negotiation WAN RJ45 port
 • Built-in firewall supporting IP address filtering, Domain Name filtering, and MAC address filtering
 • Supports access control based on time of day, parents and network administrators can establish restricted access policies for children or staffs
 • Supports firmware upgrade, Remote and Web management
Description
 
   With 4 LAN ports, TL-R460 Multifunctional Broadband Router is especially designed for small enterprise, office and SOHO(Small Office/Home Office) to access the Internet. It features strong functions, high performance, and easy configuration router. The TL-R460 provides many management functions, including system, DHCP server, virtual server, DMZ host, firewall, and static routing table, additionally, it features much more advanced functions, such as Parental Control, IEEE802.1X Authentication, UPnP, DDNS, VPN Pass-through and System Log and so on.

   The TL-R460 router provides flexible access control, limiting staff or children to browse selected sites. The TL-R460 router is also a smart helper. It connects to the Internet automatically on demand and disconnects when idle to save on network costs. It's easy to configure. Quick Setup Wizard is supported and friendly help pages are provided for every step also.
 
 
 
Features
 
 • Complies with IEEE802.3, IEEE802.3u standards
 • 1 10/100Mbps Auto-Negotiation WAN RJ45 port, 4 10/100Mbps Auto-Negotiation LAN ports, supporting Auto-MDI/MDIX
 • Shares data and Internet access for Stations, connecting Internet through PPPoE on demand and disconnecting when idle
 • Supports TCP/IP, PPPoE, DHCP, ICMP, NAT
 • Built-in NAT and DHCP server supporting static IP address distributing
 • Built-in firewall supporting IP address filtering, Domain Name filtering, and MAC address filtering
 • Supports Virtual Server, Special Application, and DMZ host
 • Supports UPnP, Dynamic DNS, Static Routing, Flow Statistics, VPN pass-through
 • Supports connecting/disconnecting Internet on a specified time of day
 • Supports access control based on time of day, parents and network administrators can establish restricted access policies for children or staffs
 • Provides 802.1x authentication for WAN port
 • Supports ICMP-FLOOD, UDP-FLOOD, TCP-SYN-FLOOD filter
 • Ignores Ping packets from WAN or LAN ports
 • Supports firmware upgrade, Remote and Web management
 
 
SPECIFICATIONS
 
Standard and Protocol IEEE 802.3, IEEE 802.3u, IEEE 802.3x, IEEE 802.1X, TCP/IP, DHCP,ICMP, NAT, PPPoE, SNTP
Port LAN: 4 10/100M Auto-Negotiation RJ45 ports(Auto MDI/MDIX)
WAN: 1 10/100M Auto-Negotiation RJ45 port (Auto MDI/MDIX)
Network Media 10BASE-T: UTP category 3, 4, 5 cable (maximum 100m)
EIA/TIA-568 100Ω STP (maximum 100m)
100BASE-TX: UTP category 5, 5e cable (maximum 100m)
EIA/TIA-568 100Ω STP (maximum 100m)
LED Indicators LAN/WAN: Link/Act, 100Mbps
Else: M1, M2
Power and Consumption Input: 9V~50Hz 0.8A
Consumption: 3.6W(Max)
Safety & Emission FCC, CE
Dimensions (L x W x H) 186 x 146 x 44 mm
Operating environment Operating Temperature: 0~40°C
Storage Temperature: -40~70°C
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~95% non-condensing
 
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept