Curs valutar


1 EURO = 4.8387 RON  
1 USD = 4.3203 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpgigabitz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerplugprizaraspberry piaudiovideocable4 contactrcajackamikoac routerunifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin


 » Routere wireless


Router AC dual band, 4 antene* 5dB, 4LAN, Broadcom chipset BCM5358U, suport DDWRT

Netis - WF2471 Broadcom

600 Mbps Wireless Dual-Band Router, Multiple AP, 2.4/5GHz, 802.11 n/g/b/a, Built-in 4-port Switch, 4 antene *5dB
suporta  DDWRT
descarca manual la: 
600Mbps Wireless Dual-Band Router, 2.4/5GHz, 802.11n/g/b/a, Built-in 4-port Switch, SPI firewall, Multiple SSID, Qos, WPS Button,autorun utility, 4*5dBi fixed antenna chipset Broadcom BCM5358U

Pret vechi fara TVA :
136,86 RON

Pret nou fara TVA :
90,18 RON

Pret nou cu TVA :
107,31 RON

Disponibilitate :

Standards IEEE 802.11a,IEEE 802.11b, IEEE 802.11g, IEEE 802.11n
Signal Rate 2.4&5G 300Mbps Simultaneous
Frequency Range 2.4-2.4835GHz    5.15GHz-5.825GHz
Transmit Power 20dBm(MAX)
Data Transfer Rate                      802.11n:
40MHz(300Mbps, 270Mbps, 240Mbps, 180Mbps, 120Mbps, 90Mbps, 60Mbps, 30Mbps)
20MHz (144Mbps, 130Mbps, 115Mbps, 86Mbps, 57Mbps, 43Mbps, 28Mbps, 14Mbps) (Auto-Sense)
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
(11Mbps,9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)
Wireless Mode AP, WDS, AP+WDS, Repeater, Client, Multiple AP
Wireless Security 64/128-bit WEP,
SSID Broadcast Enable/Disable
Wireless MAC Filtering
Standards                          IEEE 802.3 10Base-T, IEEE 802.3u100Base-TX                                                      
Interface 1 * 10/100M Auto MDI/MDIX RJ45 WAN port
4 * 10/100M Auto MDI/MDIX RJ45 LAN port
Button Default, WPS
Antenna 4 * external 5dBi antennas
Power Supply DC 12V/1A(Output)
Dimensions (L xW x H ) 145 x 155 x 35 mm                                                                                                 
Weight 285g
WAN Type       DHCP(Dynamic IP), PPPoE, Static IP, WISP
Port Forwarding Virtual Servers, Port Triggering, UPnP, DMZ, FTP Private Port                                     
QoS WMM, Bandwidth Control
Access Control IP/MAC/Domain filtering
VPN Pass-through PPTP, L2TP, IPSEC
Others                                   DDNS, Static Routing, WOL, Remote Management, Firmware upgrade                
Certification       FCC, CE, KC
Environment            Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90% non-condensing                      
Storage Humidity: 5%~90% non-condensing                         
Package 1 * WF2471
1 * Quick Installation Guide
1 * Power Adapter
1 * Ethernet Cable
1 * Cradle
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept