Curs valutar


1 EURO = 4.8397 RON  
1 USD = 4.2964 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoegigabitcablu utpz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewayplugprizawirelessterouter wireless routerac routerraspberry piaudiovideocable4 contactrcajackamikounifiraspberry pi 2 model benergytkb4k3kmxsfpddmmountableantene 24ghz802.3atmeterraftsolo10gdoor phone720pcomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectriciraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbgftp5baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2cablu ftpab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascablutvcamewradvr4ch150mmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin bgftp6bgftp6pebgutp5bgutp6bgutp3bgutp5pebgftp5pebgutp6lszhbgutp6pebgutp5lszhbgsf/utp5lsnhbgftp5lszhbgftp6lszhbgf/ftp6abgf/ftp6apebgftp6alszh


 » Routere wireless


Router 300N MIMO, 3* 5dB antene detasabile, high speed, PPPoE, WISP

Netis - WF2409D netis

300 Mbps WISP client-router, 2.4GHz,  802.11 n/g/b, Built-in 4-port Switch, 3 antene externe detasabile 5dB,(3T/3R);
Foloseste ca motor chipset Broadcom de inalta performanta;

WAN Type DHCP(Dynamic IP), PPPoE, Static IP, WISP

Pret vechi fara TVA :
92,30 RON

Pret nou fara TVA :
63,65 RON

Pret nou cu TVA :
75,75 RON

Disponibilitate :


Standard IEEE 802.11b, IEEE 802.11g, IEEE 802.11n
Signal Rate Up to 300Mbps
Frequency Range 2.4-2.4835GHz
Transmit Power 20dBm(MAX)
Data Transfer Rates               802.11n:
40MHz(300Mbps, 270Mbps, 240Mbps, 180Mbps, 120Mbps, 90Mbps, 60Mbps, 30Mbps)
20MHz (144Mbps, 130Mbps, 115Mbps, 86Mbps, 57Mbps, 43Mbps, 28Mbps, 14Mbps) (Auto-Sense)
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
(11Mbps,9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)
Wireless Mode AP, WDS, AP+WDS, Repeater, Client, Multiple AP
Wireless Security 64/128-bit WEP,
SSID Broadcast Enable/Disable
Wireless MAC Filtering
Standard IEEE 802.3 10Base-T, IEEE 802.3u100Base-TX                                                                 
Interface 1 * 10/100M Auto MDI/MDIX RJ45 WAN port
4 * 10/100M Auto MDI/MDIX RJ45 LAN port
Button Default, WPS
Antenna 3 * external 5dBi antennas
Power Supply DC 9V/500mA(Output)
Dimensions (L x W x H ) 145 x 155 x 35 mm
Weight 273 g
WAN Type                     DHCP(Dynamic IP), PPPoE, Static IP, WISP
Port Forwarding Virtual Servers, Port Triggering, UPnP, DMZ, FTP Private Port                         
QoS WMM, Application Priority, Bandwidth Control
Access Control IP/MAC/Domain filtering
VPN Pass-through PPTP, L2TP, IPSEC
Others DDNS, Static Routing, WOL, Remote Management, Firmware upgrade
Certification         FCC, CE, KC, NCC, BSMI                                                        
Environment Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
Package 1 * WF2409
1 * Quick Installation Guide
1 * Power Adapter
1 * Ethernet Cable
1 * Cradle



Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept