Curs valutar

23-Jan-2020

1 EURO = 4.7786 RON  
1 USD = 4.3095 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:

ANPC

 » Routere wireless



MW5240

Router 300N+ 4P switch cu 3G/4G support

Netis - MW5240

Router Wi-FI cu suport de conectare stickuri USB-modem viteza 3G/4G
300 Mbps Wireless  Router, 2.4GHz, 802.11 n/g/b/ac, Built-in 4-port Switch, SPI firewall, Qos, WPSButton, autorun utility, 4*5dB high gain dual antenna; Multi SSID - pana la 3 retele separate.





 

Alte imagini:
MW5240MW5240





Pret vechi fara TVA :
118,45 RON


Pret nou fara TVA :
101,97 RON

Pret nou cu TVA :
121,34 RON

Disponibilitate :
Sunati

Wireless
Standards IEEE 802.11b, IEEE 802.11g, IEEE 802.11n
Signal Rate Up to 300Mbps
Frequency Range 2.4-2.4835GHz
Transmit Power 20dBm(MAX)
Data Transfer Rate 802.11n:
40MHz  (300Mbps, 270Mbps, 240Mbps, 180Mbps, 120Mbps, 90Mbps, 60Mbps, 30Mbps)
20MHz  (144Mbps, 130Mbps, 115Mbps, 86Mbps, 57Mbps, 43Mbps, 28Mbps, 14Mbps) (Auto-Sense)
801.11g:
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
802.11b:
(11Mbps, 9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)
Wireless Mode AP, Repeater, AP+WDS, WDS, Client, Multi-SSID
Wireless Security 64/128-bit WEP,
WPA-PSK/WPA2-PSK (TKIP/AES)
SSID Broadcast Enable/Disable
Wireless MAC Filtering
Hardware
Standards IEEE 802.3 10Base-T, IEEE 802.3u 100Base-TX
Interface 1 * 10/100Mbps Auto MDI/MDIX RJ45 LAN port

2 * 10/100Mbps Auto MDI/MDIX RJ45 LAN port

1 * USB 2.0 Port, for 3G/4G USB Modem or USB Storage Device

LED WPS, USB, WAN, LAN1-LAN4, WLAN, PWR
Button WPS/Default
Antenna 4 * 5dBi Fixed Antenna
Power Supply DC 12V/1A (Output)
Software
WAN Type 3G/4G, DHCP, Static IP, PPPoE, L2TP, PPTP, Dual Access, WISP
Port Forwarding Virtual Servers, Port Triggering, UPnP, DMZ, FTP Private Port
QoS WMM, Bandwidth Control
Access Control IP/MAC/Domain Filtering
VPN Pass-through PPTP, L2TP, IPSec
Others IPTV, Dynamic DNS, Static Routing, WOL, Backup & Restore, Firmware Upgrade
Others
Certification FCC, CE
Environment Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
Package 1* MW5240
1* 12V/1A Power Adapter
1* Ethernet Cable
1* Quick Installation Guide (Multilingual)
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept