Curs valutar


1 EURO = 4.8426 RON  
1 USD = 4.3517 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpgigabitz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerplugprizaraspberry piaudiovideocable4 contactrcajackamikoac routerunifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin


 » Routere wireless


Router 300N+ 4P switch cu 3G/4G support

Netis - MW5230

Router Wi-FI cu suport de conectare stickuri USB-modem viteza 3G/4G
300 Mbps Wireless  Router, 2.4/5GHz, 802.11 n/g/b/ac, Built-in 4-port Switch, SPI firewall, Qos, WPSButton, autorun utility, 3*5dB high gain dual antenna;


Alte imagini:

Pret vechi fara TVA :
122,00 RON

Pret nou fara TVA :
105,03 RON

Pret nou cu TVA :
124,98 RON

Disponibilitate :


Standards IEEE 802.11b/g/n 2.4GHz
IEEE 802.11a/n/ac 5GHz
Signal Rate Up to 300Mbps 2.4GHz
Up to 450Mbps 5GHz
Frequency Range 2.4-2.4835GHz; 5.180-5.825GHZ
Transmit Power 20dBm(MAX)
Data Transfer Rate                         802.11ac:
40MHz(300Mbps, 270Mbps, 240Mbps, 180Mbps, 120Mbps, 90Mbps, 60Mbps, 30Mbps)
20MHz (144Mbps, 130Mbps, 115Mbps, 86Mbps, 57Mbps, 43Mbps, 28Mbps, 14Mbps) (Auto-Sense)
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
(11Mbps,9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)                                                                 
Wireless Mode AP, Repeater, AP+WDS, WDS, Client, Multi-SSID
Wireless Security    WEP/WPA-PSK/WPA2-PSK Encryption
Wireless MAC Filtering
Standards IEEE 802.3 10Base-T, IEEE 802.3u 100Base-TX                                            
Interface 1 * 10/100M Auto MDI/MDIX RJ45 WAN port
4 * 10/100M Auto MDI/MDIX RJ45 LAN por
LED Indicators PWR, WPS, SYS,2.4G, 5G LAN1 ~4, WAN , WPS
Button Default, WPS
Antenna 3 * external 5dBi detachable antenna, SMA connector
Power Supply DC 12V/1A(Output)
WAN Type       DHCP, Static IP, PPPoE, L2TP, PPTP, Dual Access, WISP
Port Forwarding Virtual Servers, Port Triggering, UPnP, DMZ, FTP Private Port
QoS WMM, Bandwidth Control
Access Control IP/MAC/Domain Filtering
VPN Pass-through                    PPTP, L2TP, IP SEC
Others                              Dynamic DNS, Static Routing, WOL, Backup & Restore, Firmware Upgrade
Certification       FCC, CE
Environment Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
Package 1* WF2710D
1* 12V/1A Power Adapter
1* Ethernet Cable
1* Quick Installation Guide
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept