Curs valutar


1 EURO = 4.7790 RON  
1 USD = 4.3101 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:


 » Routere wireless


Router 300N, 2 antene 5dB top

Netis - WF2419E (WF2419V2)

300 Mbps 2T2R Wireless N all-modes Router, 2.4GHz,  802.11 n/g/b, 1WAN + 4 LAN, 2 antene externe * 5dB



Alte imagini:

Pret vechi fara TVA :
62,83 RON

Pret nou fara TVA :
51,50 RON

Pret nou cu TVA :
61,29 RON

Disponibilitate :

Standards IEEE 802.11b, IEEE 802.11g, IEEE 802.11n
Signal Rate Up to 300Mbps
Frequency Range 2.4-2.4835GHz
Transmit Power 20dBm(MAX)
Data Transfer Rate                         802.11n:
40MHz(300Mbps, 270Mbps, 240Mbps, 180Mbps, 120Mbps, 90Mbps, 60Mbps, 30Mbps)
20MHz (144Mbps, 130Mbps, 115Mbps, 86Mbps, 57Mbps, 43Mbps, 28Mbps, 14Mbps) (Auto-Sense)
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
(11Mbps,9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)
Wireless Mode AP, Repeater, AP+WDS, WDS, Client, Multi-SSID
Wireless Security     64/128-bit WEP,
SSID Broadcast Enable/Disable
Wireless MAC Filtering
Standards IEEE 802.3 10Base-T, IEEE 802.3u 100Base-TX                                        
Interface 1 * 10/100M Auto MDI/MDIX RJ45 WAN port
4 * 10/100M Auto MDI/MDIX RJ45 LAN port
Button Default, WPS
Antenna 2 * 5dBi Fixed antennas
Power Supply DC 9V/500mA(Output)
WAN Type DHCP, Static IP, PPPoE, L2TP, PPTP, Dual Access, WISP
Port Forwarding Virtual Servers, Port Triggering, UPnP, DMZ, FTP Private Port
QoS WMM, Bandwidth Control
Access Control IP/MAC/Domain filtering
VPN Pass-through PPTP, L2TP, IPSEC
Others IPTV, Dynamic DNS, Static Routing, WOL, Backup & Restore, Firmware Upgrade
Certification                FCC, CE
Environment Operating Temperature: 0�~40�
Storage Temperature: -40�~70�
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
Package 1* WF2419E
1* WF2419E 1* 9V/500mA Power Adapter
1* Ethernet Cable
1* Quick Installation Guide (Multilingual)
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept