Curs valutar


1 EURO = 4.7537 RON  
1 USD = 4.3082 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte


 » Routere wireless


Router 150Mbps + 4P, antena 5dB, model 2018, 620Mhz, optimizat streaming video

Netis - WF2411E

WF2411E - EU version , model 2018, 620Mhz optimizat streaming video
150 Mbps 2T2R Wireless N Router, 2.4GHz,  802.11 n/g/b, 1WAN +4 LAN, antena 5dB externa.
Wireless Modes: AP, WDS, AP+WDS, Repeater, Client, Multiple AP

Pret vechi fara TVA :
42,00 RON

Pret nou fara TVA :
33,50 RON

Pret nou cu TVA :
39,87 RON

Disponibilitate :

Standard IEEE 802.11b, IEEE 802.11g, IEEE 802.11n
Signal Rate Up to 150Mbps
Frequency Range 2.4-2.4835GHz
Transmit Power 20dBm(MAX)
Data Transfer Rate               802.11n:
40MHz(150Mbps, 135Mbps, 120Mbps, 90Mbps, 60Mbps, 45Mbps, 30Mbps, 15Mbps)
20MHz (72Mbps, 65Mbps, 57Mbps, 43Mbps, 28Mbps, 21Mbps, 14Mbps, 7Mbps)
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
(11Mbps,9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)
Wireless Mode AP, WDS, AP+WDS, Repeater, Client, Multiple AP
Wireless Security                       64/128-bit WEP,
SSID Broadcast Enable/Disable
Wireless MAC Filtering
Standard IEEE 802.3 10Base-T, IEEE 802.3u 100Base-TX                                     
Interface 1 * 10/100M Auto MDI/MDIX RJ45 WAN port
4 * 10/100M Auto MDI/MDIX RJ45 LAN port
Button Default, WPS
Antenna 1 * external 5dBi antenna
Power Supply DC 9V/500mA(Output)
Dimensions (L x W x H ) 133 x 99 x 27 mm
Weight 149 g
WAN Type                           DHCP(Dynamic IP), PPPoE, Static IP, WISP
Port Forwarding Virtual Servers, Port Triggering, UPnP, DMZ, FTP Private Port
QoS WMM, Bandwidth Control
Access Control IP/MAC/Domain filtering
VPN Pass-through PPTP, L2TP, IPSEC
Others DDNS, Static Routing, WOL, Remote Management, Firmware upgrade
Certification          FCC, CE, KC
Environment Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
Package 1 * WF2411
1 * Power Adapter
1 * Ethernet Cable
1 * Quick installation Guide
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept