Curs valutar

11-Dec-2019

1 EURO = 4.7787 RON  
1 USD = 4.3149 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlan

ANPC

 » RELEE OPTICE LASER 1310nm (Receptor optic + Emitator optic)



Releu Optic pt exterior nextraCOM WT8624III

Releu Optic pt exterior

nextraCOM - OT8624III

Releu Optic pt exterior/carcasa etansa (receptor cu modul Philips + emitator laser Ortel 24mW)

Alte imagini:
Releu Optic pt exterior nextraCOM WT8624III
Pret fara TVA:
4,232.97 RON

Pret cu TVA :
5.037,24 RON

Disponibilitate :
Sunati

nextraCOM OT8624III - Outdoor Laser Relay Station
Make the Optical Receiver and Transmitter together into one equipment. It is used in transmitting long distance optical power.

Adopt high linear, optical isolation, distribution feedback and hot electricity refrigeration of EO, ORTEL and Lucent world famous band laser.

Used in offering the good quality of the picture, digital and compress signal transmission.

Built-in RF driving amplifier and controlling circuit, guarantee the index of noise and adjust.

Adopt big Aluminium housing, the complete high-reliable optical power output stability circuit and laser hot electricity refrigeration temperature stable controlling circuit.

Set-in the high-reliable switch power, can be working properly in the range of 85~254V.
 
Specifications:
OPTICAL RECEIVING
Range of Input Power mW 0.3~1.6(-5dBm~+2dBm)
Optical Connector type   FC/APC (SC/APC)
Optical Return Loss dB >45
Working Band MHz 45-860
Flatness in Band dB ±0.75
RF Output Level dBµV ≥96( the input power is -2dBm)
The adjust range of Level dB 0~10
C/N dB ≥51
C/CTB dB 60
C/CSO dB 60
Return Loss dB ≥12
Output Impedance Ω 75
OPTICAL TRANSMITTING
Output Power mW According to the request of the customers
Optical Circuit   It depends on optical power
Optical Wavelength nm 1310±20
Optical Connector type   FC/APC (SC/APC)
Channel   84
C/N dB 51
C/CTB dB 65
C/CSO dB 60
Input Laser Level dBµV 96~99
Flatness in Band dB ±0.75
GENERAL
Power Consumption W 30
Power Voltage V ~(130-265)
Operating Temperature °C 0~45
Dimension mm 483x385x44
 
Principle drawing
Releu Optic pt exterior nextraCOM WT8624III
 
1. ~220V/+12V, -12V Switch Power 2. ~220V/ +24V Switch Power
3. Laser Receiving Module 4. Forward Amplify
5. Low-noise Module 6. RF Output Variable ATT
7. RF Output Variable EQ 8. Power Double Module
9. RF Output Port 10. RF Output Test Port (-10dB)
11. Variable ATT (0-15dB) 12. Power Double Module
13. Laser Input Level Test Port 14. Optical Power Indicator Lamp
15. Optical Power Test Port, 1mW=-0.1V 16. Optical Receiving Port
17. Optical Transmit Output Port 18. Laser Transmit Module
 
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept