Curs valutar


1 EURO = 4.7794 RON  
1 USD = 4.3124 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlan


RELEE OPTICE LASER 1310nm (Receptor optic + Emitator optic)

  Descriere Pret
MW-1000Releu Optic exterior Braun_Group - MW-1000(ORT)-10mW

Releu Optic exterior carcasa etansa, modul optic receptie Philips 1100-1600nm, nivel optic intrare -8+2dBm, 2 iesiri RF 105dBuV, emitator laser coaxial 1310nm/10 mW, alimentare duala 60V telealimentare / 220V retea.

Pret vechi 1,476.83 RON
Pret nou
1,255.31 RON
*) Pretul nu contine TVA
cuTVA: 1,493.82 RON
Disponibilitate : Sunati
OT8631IIIReleu Optic pt exterior nextraCOM - OT8631III

Releu Optic exterior carcasa etansa, receptor cu modul Philips, emitator laser Ortel 31 mW

Pret : 4,824.33 RON
*) Pretul nu contine TVA
cuTVA: 5,740.95 RON
Disponibilitate : Sunati
Releu Optic pt exterior nextraCOM WT8624IIIReleu Optic pt exterior nextraCOM - OT8624III

Releu Optic pt exterior/carcasa etansa (receptor cu modul Philips + emitator laser Ortel 24mW)

Pret : 4,233.59 RON
*) Pretul nu contine TVA
cuTVA: 5,037.98 RON
Disponibilitate : Sunati
Releu Optic nextraCOM WT8624IIReleu Optic nextraCOM - WT8624II

Releu Optic pentru rack 19" (receptor optic cu modul Philips + emitator laser Ortel 24mW)

Pret : 4,036.68 RON
*) Pretul nu contine TVA
cuTVA: 4,803.65 RON
Disponibilitate : Sunati
Preturile nu contin TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept