Curs valutar

22-Jul-2019

1 EURO = 4.7315 RON  
1 USD = 4.2103 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20km

ANPC

 » Echipamente pentru receptia si transmisia digitala a canalelor de televiziune pe cablu



SMP-180

Receptor satelit profesional multicanal

Wellav - SMP-180 SRC

Receptor profesional multicanal, include 12 intrari DVB-C, 2 intrari ASI, 2 iesiri ASI, port RJ45 cu 12 IP in/out, port RJ45 pentru management, multiplexare/remultiplexare canale

Cere oferta
Disponibilitate :
La comanda

SMP260 Encoder

With the flexible modular design, SMP180 can:

  • Receive and process digital programs from up to 12 DVB-C/S/S2 channels.
  • Supports program decryption via four multi-channel CAM. modules with commonly adopted CAS in the market.
  • Be easily integrated into any headend systems for content delivery and re-distribution.

 

Features:

  • High density receiving with 1RU compact design.
  • Variety of inputs including DVB-S2, DVB-C,ASIandlP(12ln120ut).
  • Re-multipiexing and cherry picking.
  • Multi-channel decryption.
  • Independent embedded ASI and IP I/O for different applications.
  • Up to four integrated DVB common interfaces to descramble four full transport streams.
  • Re-multiplexing of channels received.
  • Supports EPG/EIT re-multiplexing. (optional)
  • Supports TS-level BISS descrambling. (future option)
  • Configuration and monitoring programs via NMS, Web GUI or SNMP.
  • High efficiency with low power consumption.


 

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept