Curs valutar

17-Nov-2019

1 EURO = 4.7667 RON  
1 USD = 4.3224 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavecablu utpstabilizator de tensiuneswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolodoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpower

ANPC

 » Receptoare de satelit digitale High Definition



ML-1100S

Receptor satelit HD PVR + IPTV STALKER (Optional)

Medialink - ML1100S

Cel mai versatil Receptor de satelit DVB-S2, Medi@Link High Definition pentru programe FTA - full HD transmise pe satelit, BLIND SCAN & FAST SCAN, USALT, PVR ( HDD extern USB-2TB max),
Ofera functii multimedia avansate IPTV CLIENT STALKER & XTREAM, (VOD RTMP, RTSP, http TS, M3U) functii avansate media player, INTERNET RADIO, SAMBA,  PVR, 45k ADULT channels redare mkv, avi, divx, xvid mpeg, ts, vob, mp3, jpeg, DLNA, Live Weather, Google MAPS, Web album: Picasa, Flickr, Yupoo , Jocuri, meniu in limba Romana, Iesire Full HD 1080p.

Permite accesarea direct din telecomanda a mii de programe TV over IPTV din toate tarile lumii si zeci de mii de VOD.
Canalul oficial de prezentare MEDIALINK de pe youtube, cu clipurile oficiale de prezentare: https://www.youtube.com/channel/UCn3eMQFyC_TocZxTiC0HoRA

Pentru functiile de IPTV sau Internet Multimedia este nevoie de adaptorul Wi-Fi sau adaptorul USB-RJ45 si acces la internet de mare viteza.

Braun Group - USB-RJ45 (Optional)

Medialink - WiFi Medialink 150Mbps mini-N USB Adapter +antena (Optional)

 

Alte imagini:
ML-1100S


Pret nou fara TVA :
110,00 RON

Pret nou cu TVA :
130,90 RON

Disponibilitate :
Sunati

Optional, stick WiFi USB compatibil AICI

 

Actualizare firmware AICI

 

Hardware Specification
MAIN CHIPSET
CPU High-Performance 667MHz 32-bit MIPS 24KEc
MEMORY
FLASH 128MB
DDR3 SDRAM 2GB

DEMODULATOR
TYPE DVB-S, DVB-S2,

DEMODULATION QPSK, 8PSK

INPUT SYMBOL RATE 1~45MS/s, SCPC and MCPC Capable

FEC MODE DVB-S: Auto, 1/2, 2/3, 3/4, 5/6, 7/8

DVB-S2,

- QPSK: Auto, 1/2, 3/5, 2/3, 4/5, 5/6, 8/9, 9/10

- 8PSK: Auto, 3/5, 2/3, 3/4, 5/6, 8/9, 9/10

SATELLITE TUNER
NUMBER OF TUNERS 1
INPUT/OUTPUT CONNECTOR F-Type, IEC 169-24, Female
INPUT FREQUENCY RANGE 950MHz ~ 2150MHz
INPUT SIGNAL LEVEL -65dBm ∼ -25dBm
CONNECTOR 75Ω Unbalanced
INPUT IMPEDANCE
Vertical: +13.5V (+14.5V at high voltage)
Horizontal: +18V (+18.5V at high voltage)
Current: Max. 500mA (Short Circuit Protection)
22KHz TONE Frequency 22KHz±4KHZ
Amplitude 0.6±0.2Vpp
DiSEqC CONTROL 1.0, 1.1 & 1.2 Version Compliant
CHANNEL SELECTION PLL Frequency Synthesizer

VIDEO DECODER
TRANSPORT STREAM MPEG-2 ISO/IEC 13818-2
MPEG-4 Part 2
PROFILE LEVEL MPEG-2 MP@ML, MPEG-2 MP@HL
MPEG-4 AVC/H.264 HP@L4.1
VIDEO FORMAT 4:3, 16:9, Letter Box
VIDEO RESOLUTION 1080p, 1080i, 720p, 576p, 576i, 480p, 480i

AUDIO DECODER
AUDIO DECODING MPEG/MusiCam Layer I & II, AC3 Down Mix
AUDIO MODE Mono / Dual / Joint Stereo / Stereo
AUDIO BIT RATE 32Kbits/s – 384Kbits/s
SAMPLING FREQUENCY 32, 44.1, 48KHz

AUDIO / VIDEO / DATA INPUT/OUTPUT
VIDEO OUTPUT 1 x RCA Cinch
AUDIO OUTPUT 2 x RCA Cinch (L/R)
DIGITAL AUDIO OUTPUT 1 x S/PDIF (RCA)
RS-232C 9 Pin D-Sub Socket Type (Max.115200bps)
HDMI 1 x HDMI 1.3
USB 2 x (USB 2.0 Host), Front & Rear

POWER SUPPLY
INPUT VOLTAGE AC 90~250V, 50/60Hz
TYPE SMPS (Switching Mode Power Supply)
PROTECTION Separate internal fuse
The input should be protected against lighting.

PHYSICAL CHARACTERISTICS
DIMENSION (W x H x D) 220 x 40 x135 (mm) 
NET WEIGHT Approx. 1.1 Kg
OPERATING TEMPERATURE 0℃ to +45℃
STORAGE TEMPERATURE -10℃ to +70℃

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept