Curs valutar


1 EURO = 4.7315 RON  
1 USD = 4.2103 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20km


 » Echipamente pentru receptia si transmisia digitala a canalelor de televiziune pe cablu

Receptor profesional SD

Receptor profesional SD

Wellav - UMH-160R RL

Receptor profesional SD, 1 intrare DVB-T/S2/C, slot CI multidecript (decodare numai 1 canal MPEG2), ASI out, RJ-45 pt management

Cere oferta
Disponibilitate :
La comanda

UMH160R Receiver/Decoder

UMH160R can receive digital signals from various of inputs (DVB-S/S2, DVB-C, DVB-T/ISDB-T, ASI and IP), decrypt, process/select programs to various outputs including CVBS, HDMI, SD/HD SDI, ASI, TS/IP and QAM/OFDM. It supports multi-channel descrambling, multiplexing, external table/data insertion, transcoding and transmodulating. It also supports video decoding with two audio channels. With remote web-based management interfaces, it is ideal to support advanced content distribution, real-time signal conversion and transmission via IP. 


  • Receive MPEG-2/H.264 signals from two transponders (DVB-S2) or two frequencies (DVB-C, DVB-T or ISDB-T).
  • Decrypt multi-channel programs by Conax, Irdeto, NDS, Viacess, Verimatrix, BISS-1/BISS-E or other DVB-based condition access systems via dual independent CI slots.
  • Optional four-channel Annex A/B QAM output or two-channel OFDM output, ideal for transmodulation
  • Support program multiplexing, filtering, AD/EPG insertion and cherry picking.
  • Support two pairs of audio decoding
  • Support balanced/unbalanced analog audios, GPI and cue tone
  • Optional 4 channel MPEG2 to/from H264 transcoding ( 2 for HD programs)
  • Web-based management interface


DVB-S/S2 Input


2XRF input per unit




Symbol Rate



1~45 Msps (QPSK: 1/2,2/3,3/4,5/6,7/8),


1~31.5 Msps (QPSK: 1/2,3/5,2/3,3/4,5/6,8/9,9/10;
8PSK: 3/5,2/3,3/4,5/6,8/9, 9/10 )

Input Frequency

950~2150 MHz

Signal Level

~-65~-25 dBm

Acquisition Range

+/- 5 MHz

Tuner Step Size

100 KHz

Return Loss

>10 dB

LNB Power

Vertical: 11.5V~14.0V,  Horizontal: 16.0V~19.0V,

22K Switch


QAM RF Input (optional)


Input Frequency Range

48 -862 MHz

RF Channel

4 (6/7/8 MHz) per module

QAM Modulation Mode

16/32/64/128/256 QAM

QAM Type

ITU-T J.83 Annex A/ C, Annex B (64/256QAM)

Symbol Rate

1.0~6.9 MBauds

RF input bit-rate

up to 55 Mbps

QAM RF Input (optional)


Input Frequency Range

48 -862 MHz

RF Channel

2(6/7/8 MHz) per unit

QAM Modulation Mode

16/32/64/128/256 QAM

QAM Type

ITU-T J.83 Annex A/ C, Annex B (64/256QAM)

Symbol Rate

1.0~6.9 MBauds

RF input bit-rate

up to 55 Mbps

DVB-T/ISDB-T Input (optional)


Input Frequency Range

48 -862 MHz

RF Channel

2 (6/7/8 MHz) per unit

QAM Modulation Mode

16/64 QAM

DVB De-scrambling


DVB-CI Interfaces

up to 2 independent CI slots (EN50221)

CA Method

Multicrypt/Simulcrypt, Hot Plug


Irdeto, Conax, Viacess, Nagravision, Novel SuperTV, Verimatrix, CTI, Dvcrypt&other DVB-simulcrypt CAS

GBE IP Interface



1 x 1000 Mbps per port

IP Encapsulation




I/O Processing

Up to 12 Sockets, max at 72 Mbps per socket


Unicast and Multicast



Forward Error Correction


DVB ASI interface



4 BNC connectors (2 ASI inputs), 75Ω

MPEG Format

188/204Byte per TS

I/O Processing

1 MPTS/SPTS per port, up to 120 Mbps per port




Re-mapping and Filtering

MPTS Output Synchronization



Any Input to Any Output


Input Service Redundancy & IP Port Redundancy




100BaseTX, RJ45


Wellav Digital Service Manager

Web-based Management (future feature)

Support SNMP


Physical & Environment


Input Voltage

90 – 260 VAC

Power Consumption

Approx 40 W

Rack Space

1 RU

Dimension (WxHxD)

480mm x 44mm x 440mm

Operating Temperature

0o to 50oC

Storage Temperature

-40o to 65oC

Relative Operating Humidity



Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept